SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gxoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gxoA
Domain Number 1 Region: 24-326
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 3.15e-92
Family Family 10 polysaccharide lyase 0.0000000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gxoA   PDB: 1gxo   SUPERFAMILY: 1gxoA
Sequence length 332
Comment (A:)
Sequence
glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
nggggnesgtiangatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
itqmslerrtgyswggnygtsiinfaqkvgyl
Download sequence
Identical sequences 1gxoA 1gxo_A cath|current|1gxoA00/329-648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]