SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1r76A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r76A
Domain Number 1 Region: 10-406
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 1.46e-100
Family Family 10 polysaccharide lyase 0.00000000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1r76A   PDB: 1r76   SUPERFAMILY: 1r76A
Sequence length 408
Comment (A:)
Sequence
avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
nvakvksgsndldaardrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkg
ieyllasqfpnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppair
traleatnaaihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarill
flmeieapsdavkqairggvawlntsvirdrawvksdqgyqlvteqgakplwsrfysldg
nkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaftkwekrs
Download sequence
Identical sequences cath|current|1r76A00/25-432 d1r76a_ 1r76A 1r76_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]