SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for 1rytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rytA
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 7.39e-37
Family Ferritin 3.16e-07
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 1.09e-12
Family Rubredoxin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
fusome 2.197 7.63
chloroplast part 1.896 6.8
plastid 1.6 4.91

Protein sequence

External link(s) SCOP: 1rytA   PDB: 1ryt
Sequence length 190
Comment (A:)
Sequence
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw
Download sequence
Identical sequences 1ryt.A 1rytA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]