SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rytA
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 7.39e-37
Family Ferritin 0.000000316
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000109
Family Rubredoxin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
iron ion homeostasis 2.005 50.79
cofactor metabolic process 1.43 22.64
coenzyme biosynthetic process 1.925 22.64
transition metal ion transport 2.096 20.34
regulation of body fluid levels 1.526 19.9
defense response 1.383 19.9
humoral immune response 1.94 19.9
ion homeostasis 1.497 19.2
maintenance of location 1.483 16.17
electron transport chain 2.023 15.68
Cellular Component IC (bits) H-Score
mitochondrial envelope 1.593 15.72
mitochondrial respiratory chain 2.098 15.72
inner mitochondrial membrane protein complex 1.909 15.72
fusome 2.127 13.18
respiratory chain complex 2.02 12.06
oxidoreductase complex 1.774 12.02
organelle inner membrane 1.692 9.2
thylakoid 2.204 8.86
chloroplast part 1.842 6.2
cytosolic part 1.678 5.13

Protein sequence

External link(s) SCOP: 1rytA   PDB: 1ryt
Sequence length 190
Comment (A:)
Sequence
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw
Download sequence
Identical sequences 1ryt.A 1rytA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]