SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1rytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rytA
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 7.39e-37
Family Ferritin 0.000000316
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000109
Family Rubredoxin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosol 1.295 64.93
fusome 2.182 15.07
oxidoreductase complex 1.828 13.98
respiratory chain complex 2.067 12.16
thylakoid 2.192 8.56
mitochondrial respiratory chain 2.143 7.85
inner mitochondrial membrane protein complex 1.946 7.85
organelle envelope 1.405 6.01
plastid 1.525 4.44

Protein sequence

External link(s) SCOP: 1rytA   PDB: 1ryt
Sequence length 190
Comment (A:)
Sequence
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw
Download sequence
Identical sequences 1rytA 1ryt.A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]