SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for 1rytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rytA
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 7.39e-37
Family Ferritin 0.000000316
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000109
Family Rubredoxin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
sequestering of metal ion 2.197 45.06
negative regulation of apoptotic process 1.352 31.93
coenzyme metabolic process 1.622 30.76
innate immune response 1.612 21.19
wound healing 1.379 21.19
regulation of body fluid levels 1.41 21.19
coagulation 1.642 21.19
humoral immune response 1.887 21.19
metal ion homeostasis 1.489 17.35
hydrogen transport 2.17 14.71
Cellular Component IC (bits) H-Score
oxidoreductase complex 1.872 11.31
fusome 2.197 7.65
chloroplast part 1.896 6.8
plastid 1.6 4.87

Protein sequence

External link(s) SCOP: 1rytA   PDB: 1ryt
Sequence length 190
Comment (A:)
Sequence
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw
Download sequence
Identical sequences 1ryt.A 1rytA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]