SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for 1rytA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rytA
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 7.39e-37
Family Ferritin 3.16e-07
Further Details:      
 
Domain Number 2 Region: 149-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 1.09e-12
Family Rubredoxin 0.0002
Further Details:      
 

Protein sequence

External link(s) SCOP: 1rytA   PDB: 1ryt
Sequence length 190
Comment (A:)
Sequence
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw
Download sequence
Identical sequences 1ryt.A 1rytA

Jump to [ Top of page · Domain architecture · Domain assignment details ]