SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1v49A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v49A
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-73
Family GABARAP-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v49A   PDB: 1v49   SUPERFAMILY: 1v49A
Sequence length 120
Comment (A:)
Sequence
mpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnm
selikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqetfg
Download sequence
Identical sequences 001933334|e2n9xA1|221.1.1.3|A:1-120 cath|current|1v49A00/1-120 d1v49a_ 1v49A 1v49_A 2n9x_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]