SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1wnoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wnoA
Domain Number 1 Region: 1-269,331-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.02e-111
Family Type II chitinase 0.0000000000134
Further Details:      
 
Domain Number 2 Region: 261-322
Classification Level Classification E-value
Superfamily Chitinase insertion domain 3.67e-21
Family Chitinase insertion domain 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wnoA   PDB: 1wno
Sequence length 395
Comment (A:)
Sequence
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplygrsfantdgpgkpyngvgqgswengvwdykalpqagate
hvlpdimasysydatnkflisydnpqvanlksgyikslglggamwwdsssdktgsdslit
tvvnalggtgvfeqsqneldypvsqydnlrngmqt
Download sequence
Identical sequences 1wno_A 1wno_B 1wnoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]