SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2o9oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o9oA
Domain Number 1 Region: 1-239,307-358
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.92e-95
Family Type II chitinase 0.0000000000893
Further Details:      
 
Domain Number 2 Region: 240-307
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.4e-23
Family Chitinase insertion domain 0.00000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2o9oA   PDB: 2o9o
Sequence length 361
Comment (A:)
Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLN
TLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLW
PGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFI
SLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFG
RSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKG
NQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLAR
V
Download sequence
Identical sequences 1tfv_A 2o9o_A 2qf8_A 4mav_A 4ml4_A 4mpk_A 4mtv_A 4nsb_A 4q7n_A 2o9oA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]