SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2pi6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pi6A
Domain Number 1 Region: 1-239,307-358
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.81e-95
Family Type II chitinase 0.0000000000664
Further Details:      
 
Domain Number 2 Region: 240-307
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.31e-24
Family Chitinase insertion domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pi6A   PDB: 2pi6
Sequence length 361
Comment (A:)
Sequence
yklicyytswsqyregdgscfpdaidpflcthviytfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
rsftlassktdvgapvsgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
a
Download sequence
Identical sequences 2pi6_A 5z4v_A 2pi6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]