SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2z0dB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2z0dB
Domain Number 1 Region: 10-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.84e-73
Family GABARAP-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2z0dB   PDB: 2z0d
Sequence length 125
Comment (B:)
Sequence
gplgsmpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyas
qetfg
Download sequence
Identical sequences 1ugm_A 2z0d_B cath|current|1ugmA00/5-117 cath|current|2z0dB00/5-120 2z0dB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]