SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000011799 from Canis familiaris 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011799
Domain Number 1 Region: 301-497
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.59e-69
Family Hemopexin-like domain 7.46e-06
Further Details:      
 
Domain Number 2 Region: 89-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-57
Family Matrix metalloproteases, catalytic domain 1.07e-07
Further Details:      
 
Domain Number 3 Region: 7-72
Classification Level Classification E-value
Superfamily PGBD-like 6.75e-20
Family MMP N-terminal domain 0.0041
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCAFP00000011799   Gene: ENSCAFG00000007966   Transcript: ENSCAFT00000012740
Sequence length 573
Comment pep:known_by_projection chromosome:CanFam3.1:24:24233418:24255725:1 gene:ENSCAFG00000007966 transcript:ENSCAFT00000012740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSLSCVFQNWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIE
WMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF
DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI
GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF
KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPST
PGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAA
YERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFK
GERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKL
SVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILS
LCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences F1Q270
ENSCAFP00000011799 ENSCAFP00000011799

Jump to [ Top of page · Domain architecture · Domain assignment details ]