SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000026871 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026871
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-50
Family Hemopexin-like domain 0.00058
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-42
Family Matrix metalloproteases, catalytic domain 6.7e-05
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-15
Family MMP N-terminal domain 0.0083
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.68
endopeptidase activity 1.539 149.06
zinc ion binding 1.658 43.63
integrin binding 1.752 16.89
cytokine receptor binding 2.034 15.07
growth factor receptor binding 1.996 15.07
enzyme activator activity 1.402 14.46
amide binding 1.714 13.22
collagen binding 1.837 10.42
protein complex binding 1.49 7.68
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.15 9.58
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.9
clathrin-coated vesicle 1.877 7.9
dendrite 1.544 7.13
synapse part 1.52 5.81
Biological Process IC (bits) H-Score
multicellular organismal macromolecule metabolic process 2.096 51.92
response to light stimulus 1.445 44.78
regulation of cytokine production 1.55 43.33
protein processing 1.807 42.16
proteolysis 1.342 38.76
peptide metabolic process 1.567 38.1
regulation of systemic arterial blood pressure 1.951 27.4
multi-organism behavior 1.851 26.92
interspecies interaction between organisms 1.592 26.41
modification by symbiont of host morphology or physiology 2.008 26.41

Protein sequence

External link(s) Protein: ENSCAFP00000026871   Gene: ENSCAFG00000018182   Transcript: ENSCAFT00000028893
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:9:37884658:37907127:1 gene:ENSCAFG00000018182 transcript:ENSCAFT00000028893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRALWLLLWGGLDAQLAERGGQELRREAEAFLEKYGYLNEQVPKDLTSARFS
NAIREFQWVSQLPISGVLDPVTLRQMTRPRCGVADTDSQAAWNERVSALFAGGRAKMRRK
KRFAKQGSKWYKQHLSYRLVNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATVPAD
IRLTFFQGDHNDGLGNAFDGPGGALGHAFLPRRGEAHFDGDERWSLSRRRGRNLFVGLAH
EIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQGLYGKPQGGSVAIQLPGKLF
TDFEAWDPHRPQGRRPEIQGPKYCHSSFDAITVDGQQRLYIFQGSHFWEVAPDGNVSEPL
PLQERWAGLPPHIEAAAVSLDSGDFHFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDA
ALFFPPLGRLVLFKGARYYVLARDGLQVEPYYPRGLQDWGGVPKEVNGALPRPDGSIIFF
RDDRYWRLDQAKLQATAWGRWAAELPWMGCWHANSEGALF
Download sequence
Identical sequences E2RPL5
ENSCAFP00000026871 ENSCAFP00000026871 9615.ENSCAFP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]