SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000026871 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026871
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-50
Family Hemopexin-like domain 0.00058
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-42
Family Matrix metalloproteases, catalytic domain 0.000067
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000408
Family MMP N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSCAFP00000026871   Gene: ENSCAFG00000018182   Transcript: ENSCAFT00000028893
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:9:37884658:37907127:1 gene:ENSCAFG00000018182 transcript:ENSCAFT00000028893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRALWLLLWGGLDAQLAERGGQELRREAEAFLEKYGYLNEQVPKDLTSARFS
NAIREFQWVSQLPISGVLDPVTLRQMTRPRCGVADTDSQAAWNERVSALFAGGRAKMRRK
KRFAKQGSKWYKQHLSYRLVNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATVPAD
IRLTFFQGDHNDGLGNAFDGPGGALGHAFLPRRGEAHFDGDERWSLSRRRGRNLFVGLAH
EIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQGLYGKPQGGSVAIQLPGKLF
TDFEAWDPHRPQGRRPEIQGPKYCHSSFDAITVDGQQRLYIFQGSHFWEVAPDGNVSEPL
PLQERWAGLPPHIEAAAVSLDSGDFHFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDA
ALFFPPLGRLVLFKGARYYVLARDGLQVEPYYPRGLQDWGGVPKEVNGALPRPDGSIIFF
RDDRYWRLDQAKLQATAWGRWAAELPWMGCWHANSEGALF
Download sequence
Identical sequences E2RPL5
ENSCAFP00000026871 ENSCAFP00000026871 9615.ENSCAFP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]