SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSCAFP00000026871 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026871
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-50
Family Hemopexin-like domain 0.00058
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-42
Family Matrix metalloproteases, catalytic domain 0.000067
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000408
Family MMP N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07

Protein sequence

External link(s) Protein: ENSCAFP00000026871   Gene: ENSCAFG00000018182   Transcript: ENSCAFT00000028893
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:9:37884658:37907127:1 gene:ENSCAFG00000018182 transcript:ENSCAFT00000028893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRALWLLLWGGLDAQLAERGGQELRREAEAFLEKYGYLNEQVPKDLTSARFS
NAIREFQWVSQLPISGVLDPVTLRQMTRPRCGVADTDSQAAWNERVSALFAGGRAKMRRK
KRFAKQGSKWYKQHLSYRLVNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATVPAD
IRLTFFQGDHNDGLGNAFDGPGGALGHAFLPRRGEAHFDGDERWSLSRRRGRNLFVGLAH
EIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQGLYGKPQGGSVAIQLPGKLF
TDFEAWDPHRPQGRRPEIQGPKYCHSSFDAITVDGQQRLYIFQGSHFWEVAPDGNVSEPL
PLQERWAGLPPHIEAAAVSLDSGDFHFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDA
ALFFPPLGRLVLFKGARYYVLARDGLQVEPYYPRGLQDWGGVPKEVNGALPRPDGSIIFF
RDDRYWRLDQAKLQATAWGRWAAELPWMGCWHANSEGALF
Download sequence
Identical sequences E2RPL5
9615.ENSCAFP00000026871 ENSCAFP00000026871 ENSCAFP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]