SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000026871 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026871
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-50
Family Hemopexin-like domain 0.00058
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-42
Family Matrix metalloproteases, catalytic domain 6.7e-05
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-15
Family MMP N-terminal domain 0.0083
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCAFP00000026871   Gene: ENSCAFG00000018182   Transcript: ENSCAFT00000028893
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:9:37884658:37907127:1 gene:ENSCAFG00000018182 transcript:ENSCAFT00000028893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRALWLLLWGGLDAQLAERGGQELRREAEAFLEKYGYLNEQVPKDLTSARFS
NAIREFQWVSQLPISGVLDPVTLRQMTRPRCGVADTDSQAAWNERVSALFAGGRAKMRRK
KRFAKQGSKWYKQHLSYRLVNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATVPAD
IRLTFFQGDHNDGLGNAFDGPGGALGHAFLPRRGEAHFDGDERWSLSRRRGRNLFVGLAH
EIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQGLYGKPQGGSVAIQLPGKLF
TDFEAWDPHRPQGRRPEIQGPKYCHSSFDAITVDGQQRLYIFQGSHFWEVAPDGNVSEPL
PLQERWAGLPPHIEAAAVSLDSGDFHFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDA
ALFFPPLGRLVLFKGARYYVLARDGLQVEPYYPRGLQDWGGVPKEVNGALPRPDGSIIFF
RDDRYWRLDQAKLQATAWGRWAAELPWMGCWHANSEGALF
Download sequence
Identical sequences E2RPL5
ENSCAFP00000026871 ENSCAFP00000026871 9615.ENSCAFP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details ]