SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000026871 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000026871
Domain Number 1 Region: 321-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-50
Family Hemopexin-like domain 0.00058
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-42
Family Matrix metalloproteases, catalytic domain 0.000067
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000408
Family MMP N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSCAFP00000026871   Gene: ENSCAFG00000018182   Transcript: ENSCAFT00000028893
Sequence length 520
Comment pep:known_by_projection chromosome:CanFam3.1:9:37884658:37907127:1 gene:ENSCAFG00000018182 transcript:ENSCAFT00000028893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRALWLLLWGGLDAQLAERGGQELRREAEAFLEKYGYLNEQVPKDLTSARFS
NAIREFQWVSQLPISGVLDPVTLRQMTRPRCGVADTDSQAAWNERVSALFAGGRAKMRRK
KRFAKQGSKWYKQHLSYRLVNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATVPAD
IRLTFFQGDHNDGLGNAFDGPGGALGHAFLPRRGEAHFDGDERWSLSRRRGRNLFVGLAH
EIGHTLGLAHSPAPRALMAPYYKRLGRDALLSWDDVLAVQGLYGKPQGGSVAIQLPGKLF
TDFEAWDPHRPQGRRPEIQGPKYCHSSFDAITVDGQQRLYIFQGSHFWEVAPDGNVSEPL
PLQERWAGLPPHIEAAAVSLDSGDFHFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDA
ALFFPPLGRLVLFKGARYYVLARDGLQVEPYYPRGLQDWGGVPKEVNGALPRPDGSIIFF
RDDRYWRLDQAKLQATAWGRWAAELPWMGCWHANSEGALF
Download sequence
Identical sequences E2RPL5
ENSCAFP00000026871 ENSCAFP00000026871 9615.ENSCAFP00000026871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]