SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000030466 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030466
Domain Number 1 Region: 97-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.42e-54
Family Matrix metalloproteases, catalytic domain 0.000000403
Further Details:      
 
Domain Number 2 Region: 21-92
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
nucleoplasm part 1.496 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSCAFP00000030466   Gene: ENSCAFG00000015080   Transcript: ENSCAFT00000035230
Sequence length 267
Comment pep:known chromosome:CanFam3.1:5:29187902:29194899:1 gene:ENSCAFG00000015080 transcript:ENSCAFT00000035230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAVLCALCLLPSCLALPLPREAGGMSEPQWKQAQDYLKRFYPSDSKTRDADSFKTKLK
EMQKFFRLPVTGILNSRTIEIMQKPRCGVPDVAHFSLFPNRPKWTSEVITYRIASYTPDL
PRFRVNQLVAKALAMWSKEIPLSFRRVPRGTADIMIGFARGAHGDYYPFDGPGNILAHAF
APGPDLGGDAHFDEDERWTDGSRIGINFLIAATHELGHSLGLGHSSDPDAVMYPTYSIRD
SKSFKLSQDDIEGIQKLYVLQDNPQQR
Download sequence
Identical sequences E2R288
ENSCAFP00000022222 ENSCAFP00000030466 9615.ENSCAFP00000030466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]