SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCAFP00000030466 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030466
Domain Number 1 Region: 97-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.42e-54
Family Matrix metalloproteases, catalytic domain 4.03e-07
Further Details:      
 
Domain Number 2 Region: 21-92
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCAFP00000030466   Gene: ENSCAFG00000015080   Transcript: ENSCAFT00000035230
Sequence length 267
Comment pep:known chromosome:CanFam3.1:5:29187902:29194899:1 gene:ENSCAFG00000015080 transcript:ENSCAFT00000035230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAVLCALCLLPSCLALPLPREAGGMSEPQWKQAQDYLKRFYPSDSKTRDADSFKTKLK
EMQKFFRLPVTGILNSRTIEIMQKPRCGVPDVAHFSLFPNRPKWTSEVITYRIASYTPDL
PRFRVNQLVAKALAMWSKEIPLSFRRVPRGTADIMIGFARGAHGDYYPFDGPGNILAHAF
APGPDLGGDAHFDEDERWTDGSRIGINFLIAATHELGHSLGLGHSSDPDAVMYPTYSIRD
SKSFKLSQDDIEGIQKLYVLQDNPQQR
Download sequence
Identical sequences E2R288
ENSCAFP00000030466 ENSCAFP00000022222 9615.ENSCAFP00000030466

Jump to [ Top of page · Domain architecture · Domain assignment details ]