SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030466 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030466
Domain Number 1 Region: 97-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.42e-54
Family Matrix metalloproteases, catalytic domain 0.000000403
Further Details:      
 
Domain Number 2 Region: 21-92
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66

Protein sequence

External link(s) Protein: ENSCAFP00000030466   Gene: ENSCAFG00000015080   Transcript: ENSCAFT00000035230
Sequence length 267
Comment pep:known chromosome:CanFam3.1:5:29187902:29194899:1 gene:ENSCAFG00000015080 transcript:ENSCAFT00000035230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAVLCALCLLPSCLALPLPREAGGMSEPQWKQAQDYLKRFYPSDSKTRDADSFKTKLK
EMQKFFRLPVTGILNSRTIEIMQKPRCGVPDVAHFSLFPNRPKWTSEVITYRIASYTPDL
PRFRVNQLVAKALAMWSKEIPLSFRRVPRGTADIMIGFARGAHGDYYPFDGPGNILAHAF
APGPDLGGDAHFDEDERWTDGSRIGINFLIAATHELGHSLGLGHSSDPDAVMYPTYSIRD
SKSFKLSQDDIEGIQKLYVLQDNPQQR
Download sequence
Identical sequences E2R288
ENSCAFP00000030466 9615.ENSCAFP00000030466 ENSCAFP00000022222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]