SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSCAFP00000030466 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030466
Domain Number 1 Region: 97-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.42e-54
Family Matrix metalloproteases, catalytic domain 0.000000403
Further Details:      
 
Domain Number 2 Region: 21-92
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74
nucleoplasm part 1.418 5.58

Protein sequence

External link(s) Protein: ENSCAFP00000030466   Gene: ENSCAFG00000015080   Transcript: ENSCAFT00000035230
Sequence length 267
Comment pep:known chromosome:CanFam3.1:5:29187902:29194899:1 gene:ENSCAFG00000015080 transcript:ENSCAFT00000035230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAVLCALCLLPSCLALPLPREAGGMSEPQWKQAQDYLKRFYPSDSKTRDADSFKTKLK
EMQKFFRLPVTGILNSRTIEIMQKPRCGVPDVAHFSLFPNRPKWTSEVITYRIASYTPDL
PRFRVNQLVAKALAMWSKEIPLSFRRVPRGTADIMIGFARGAHGDYYPFDGPGNILAHAF
APGPDLGGDAHFDEDERWTDGSRIGINFLIAATHELGHSLGLGHSSDPDAVMYPTYSIRD
SKSFKLSQDDIEGIQKLYVLQDNPQQR
Download sequence
Identical sequences E2R288
ENSCAFP00000022222 9615.ENSCAFP00000030466 ENSCAFP00000030466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]