SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0182694 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182694
Domain Number 1 Region: 69-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-28
Family Cold shock DNA-binding domain-like 0.0000461
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000356
Family ECR1 N-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.182 53.06
replication fork 2.213 37.25
nucleoplasm part 1.369 33.64
chromosomal region 1.996 30.26
protein-DNA complex 1.923 25.92
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
nuclear chromosome part 1.842 24
ribosomal subunit 1.983 22.4
chromosomal part 1.512 22.28
intracellular ribonucleoprotein complex 1.368 20.13

Protein sequence

External link(s) Protein: FBpp0182694   Gene: FBgn0156188   Transcript: FBtr0184202
Sequence length 205
Comment type=protein; loc=scaffold_1:complement(7966024..7966479,7966542..7966703); ID=FBpp0182694; name=Dper\GL18587-PA; parent=FBgn0156188,FBtr0184202; dbxref=FlyBase:FBpp0182694,FlyBase_Annotation_IDs:GL18587-PA,GB_protein:EDW29121,REFSEQ:XP_002015125,FlyMine:FBpp0182694; MD5=ace7281a730a4532a2a03c4d85df86b5; length=205; release=r1.3; species=Dper;
Sequence
MSSEGDENTVVCLPGERLCRVEDNVVLGIGTYEQNGYIYASKSGVVNIEESGENCQVVSV
HKPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR
VDIYKSFKPGDVILARVINQMEQSFLITTAETELGVVVAYASDARKTRVPMVPVGWSEMQ
CPLTTIKEPRKVAKVLPESSINIIK
Download sequence
Identical sequences B4G9U1
FBpp0182694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]