SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0182694 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182694
Domain Number 1 Region: 69-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-28
Family Cold shock DNA-binding domain-like 4.61e-05
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 3.56e-11
Family ECR1 N-terminal domain-like 0.0045
Further Details:      
 

Protein sequence

External link(s) Protein: FBpp0182694   Gene: FBgn0156188   Transcript: FBtr0184202
Sequence length 205
Comment type=protein; loc=scaffold_1:complement(7966024..7966479,7966542..7966703); ID=FBpp0182694; name=Dper\GL18587-PA; parent=FBgn0156188,FBtr0184202; dbxref=FlyBase:FBpp0182694,FlyBase_Annotation_IDs:GL18587-PA,GB_protein:EDW29121,REFSEQ:XP_002015125,FlyMine:FBpp0182694; MD5=ace7281a730a4532a2a03c4d85df86b5; length=205; release=r1.3; species=Dper;
Sequence
MSSEGDENTVVCLPGERLCRVEDNVVLGIGTYEQNGYIYASKSGVVNIEESGENCQVVSV
HKPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR
VDIYKSFKPGDVILARVINQMEQSFLITTAETELGVVVAYASDARKTRVPMVPVGWSEMQ
CPLTTIKEPRKVAKVLPESSINIIK
Download sequence
Identical sequences B4G9U1
FBpp0182694

Jump to [ Top of page · Domain architecture · Domain assignment details ]