SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0182694 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182694
Domain Number 1 Region: 69-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-28
Family Cold shock DNA-binding domain-like 0.0000461
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000356
Family ECR1 N-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.26
nucleoplasm part 1.496 33.77
replication fork 2.208 33.63
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.414 20.38
ribosomal subunit 2.011 19.55
transferase complex 1.423 12.34
DNA repair complex 2.141 10.11
chromosomal region 1.98 9.54
nuclear chromosome 1.73 8.97
Biological Process IC (bits) H-Score
DNA replication 1.891 48.73
DNA duplex unwinding 1.985 47.01
double-strand break repair 1.882 44.57
tRNA aminoacylation 2.003 38.49
translation 1.518 35.28
DNA repair 1.506 32.47
telomere organization 2.075 26.4
mRNA metabolic process 1.622 21.42
positive regulation of cellular catabolic process 1.376 21.42
RNA processing 1.457 21.42

Protein sequence

External link(s) Protein: FBpp0182694   Gene: FBgn0156188   Transcript: FBtr0184202
Sequence length 205
Comment type=protein; loc=scaffold_1:complement(7966024..7966479,7966542..7966703); ID=FBpp0182694; name=Dper\GL18587-PA; parent=FBgn0156188,FBtr0184202; dbxref=FlyBase:FBpp0182694,FlyBase_Annotation_IDs:GL18587-PA,GB_protein:EDW29121,REFSEQ:XP_002015125,FlyMine:FBpp0182694; MD5=ace7281a730a4532a2a03c4d85df86b5; length=205; release=r1.3; species=Dper;
Sequence
MSSEGDENTVVCLPGERLCRVEDNVVLGIGTYEQNGYIYASKSGVVNIEESGENCQVVSV
HKPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR
VDIYKSFKPGDVILARVINQMEQSFLITTAETELGVVVAYASDARKTRVPMVPVGWSEMQ
CPLTTIKEPRKVAKVLPESSINIIK
Download sequence
Identical sequences B4G9U1
FBpp0182694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]