SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0182694 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182694
Domain Number 1 Region: 69-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-28
Family Cold shock DNA-binding domain-like 0.0000461
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000356
Family ECR1 N-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.127 52.82
replication fork 2.242 37.57
protein-DNA complex 2.242 33.98
chromosomal region 1.935 31.1
nuclear chromosome 1.727 23.98
chromosomal part 1.471 22.3
ribosomal subunit 1.948 22.06
intracellular ribonucleoprotein complex 1.323 19.98
nucleoplasm part 1.424 12.33
cytosolic ribosome 2.062 9.5

Protein sequence

External link(s) Protein: FBpp0182694   Gene: FBgn0156188   Transcript: FBtr0184202
Sequence length 205
Comment type=protein; loc=scaffold_1:complement(7966024..7966479,7966542..7966703); ID=FBpp0182694; name=Dper\GL18587-PA; parent=FBgn0156188,FBtr0184202; dbxref=FlyBase:FBpp0182694,FlyBase_Annotation_IDs:GL18587-PA,GB_protein:EDW29121,REFSEQ:XP_002015125,FlyMine:FBpp0182694; MD5=ace7281a730a4532a2a03c4d85df86b5; length=205; release=r1.3; species=Dper;
Sequence
MSSEGDENTVVCLPGERLCRVEDNVVLGIGTYEQNGYIYASKSGVVNIEESGENCQVVSV
HKPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR
VDIYKSFKPGDVILARVINQMEQSFLITTAETELGVVVAYASDARKTRVPMVPVGWSEMQ
CPLTTIKEPRKVAKVLPESSINIIK
Download sequence
Identical sequences B4G9U1
FBpp0182694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]