SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0182694 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182694
Domain Number 1 Region: 69-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-28
Family Cold shock DNA-binding domain-like 4.61e-05
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 3.56e-11
Family ECR1 N-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.13
replication fork 2.198 34.31
nucleoplasm part 1.418 33.7
nuclear chromosome 1.72 24.48
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.418 20.29
ribosomal subunit 2.011 19.49
DNA-directed RNA polymerase complex 2.005 12.25
ribonucleoprotein granule 1.999 10.35
cytosol 1.307 7.62
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 1.996 68.7
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.887 44.68
tRNA aminoacylation 2.002 39.07
translation 1.521 35.23
telomere organization 2.104 26.38
RNA 3'-end processing 2.027 21.38
mRNA metabolic process 1.627 21.38
RNA processing 1.458 21.38
regulation of DNA replication 2.144 20.24

Protein sequence

External link(s) Protein: FBpp0182694   Gene: FBgn0156188   Transcript: FBtr0184202
Sequence length 205
Comment type=protein; loc=scaffold_1:complement(7966024..7966479,7966542..7966703); ID=FBpp0182694; name=Dper\GL18587-PA; parent=FBgn0156188,FBtr0184202; dbxref=FlyBase:FBpp0182694,FlyBase_Annotation_IDs:GL18587-PA,GB_protein:EDW29121,REFSEQ:XP_002015125,FlyMine:FBpp0182694; MD5=ace7281a730a4532a2a03c4d85df86b5; length=205; release=r1.3; species=Dper;
Sequence
MSSEGDENTVVCLPGERLCRVEDNVVLGIGTYEQNGYIYASKSGVVNIEESGENCQVVSV
HKPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR
VDIYKSFKPGDVILARVINQMEQSFLITTAETELGVVVAYASDARKTRVPMVPVGWSEMQ
CPLTTIKEPRKVAKVLPESSINIIK
Download sequence
Identical sequences B4G9U1
FBpp0182694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]