SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330821948|ref|YP_004350810.1| from Burkholderia gladioli BSR3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330821948|ref|YP_004350810.1|
Domain Number 1 Region: 50-102,180-289,651-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.89e-25
Family Viral proteases 0.052
Further Details:      
 
Domain Number 2 Region: 599-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000877
Family Viral proteases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330821948|ref|YP_004350810.1|
Sequence length 730
Comment hypothetical protein bgla_2g28830 [Burkholderia gladioli BSR3]
Sequence
MRLKLLCTASATLVAVSLLAGGIARADEGMWQPSQLPSLAPQLKHRGLALDPRQLASLKS
WPLDAVVGLGFCTASFVSPDGLIVTNHHCGYGALQYNSTPEKNLIENGFLARAKADELPT
APTQRVYVTEQVTDVTDRIEAAVPPGSDGYARYVAIDREKDRLVRECTTPGYHCQVQTFS
GGYDYQLVRQKELRDVRLVYAPPESIGKYGGDIDNWMWPRHTGDFSFLRAYVARDGSSAT
YAKDNVPYRPKHWLSVNPQGVKAGDFVMVAGYPGRTNRHLLPDELRSAIDWQYPTLIRAL
GDMNRIIDTAGKQRPAVAVAYADQVAGFNNSIKFYQGNRDELANGEALSTRREQEAALHR
WLAAQPAGGKLDAPARLADVERLNRLVDARMATRERDLILHLLQQTQLYRASYRIVRLAD
EKQKPDAEREDGFRQRDEIDLLGQQKSIDRRYDPAVDRQLLVYVLQRYVRLPADQHIGAL
DRWLGGANDASALVAKVDALYAGSRLTDQATRVALMSATPAELAASHDSWIALTRALMPD
LLAIEHVDKAQDGDEAAARAGYMKALTAYSEARGLPVYHDANLSLRVSFGTVQGYRPRDA
VEYLPFTTTDGIVQKNTGVAPFNAPAAELAAIRAHAFDGFAGPGADALPVNFLADLDIAG
GNSGSPTLDRDGKLVGLVFDGAWEGISAGWLFDPAVTRSIHVDVRYMLWVMHHLDHADNL
LREMNVAVPD
Download sequence
Identical sequences F2LR52
gi|330821948|ref|YP_004350810.1| WP_013691622.1.70250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]