SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479128945|ref|YP_005068905.1| from Arthrospira platensis NIES-39

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479128945|ref|YP_005068905.1|
Domain Number 1 Region: 80-135,165-180
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000689
Family Prokaryotic proteases 0.031
Further Details:      
 
Domain Number 2 Region: 1-57,103-148
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000994
Family Viral proteases 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479128945|ref|YP_005068905.1|
Sequence length 215
Comment hypothetical protein [Arthrospira platensis NIES-39]
Sequence
MALIQFQAPPNYAIASFHPSATLSPGDKVFGAGFHLEIDRDNIETINLNNNHSKLRDTKP
SLYHLFQPKSFLAKFPDQKYPPTRNQGFNLTRGRISFLSEKPFKNGYQIGYTNPIQKGMS
GGPLLDRWGKVVGINGMHAYPLWGDPYIYDDGEQPPPDLREKMRHLAFAIPSDRLTELAP
EFSPIPPLYITEYNGILWEFNSPDSTHFWLPPIRP
Download sequence
Identical sequences D4ZR33
gi|479128945|ref|YP_005068905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]