SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319786467|ref|YP_004145942.1| from Pseudoxanthomonas suwonensis 11-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319786467|ref|YP_004145942.1|
Domain Number 1 Region: 562-699
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 7.59e-34
Family N-acetylmuramoyl-L-alanine amidase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 256-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-21
Family Prokaryotic proteases 0.056
Further Details:      
 
Domain Number 3 Region: 753-974
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000321
Family Prokaryotic proteases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319786467|ref|YP_004145942.1|
Sequence length 1558
Comment N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [Pseudoxanthomonas suwonensis 11-1]
Sequence
MAVIRANRESIDDRFNVLGFTVRSELPLFEIALASEPELLHPSQRGRRTPGNFFTSRLMR
VQPSPHGEAVYLVPPDVVARFVGQQRLYFGLATYRDGDRSTPVSLRLPDRGSLYVSLAGL
TGRGLRRTVRGHAGNGYGGSGAELGWGGDNLDATPAPGEEPARRATNGSGATADSGYSDG
YSDELWNAPPAQPEPAAAAAPQPPASESAPAPAPTAQGLAARQRAGARALLVEPYYQPED
WWEALTTQIAHFARGAMWFLGVADTTRPPYSAICQVRVPDGSEEGSHHGTAFFIAPRLLL
TAAHVVDGQAELIIVPGKNGAGTGAASEPFGRFRASVFRKHPRYGSDGHGNDMALIQVPA
ANAAAAPNYFGLVEELNQSRPEGVVVSGYAAWWHAVSAIEHFVNANIDENRQHAHGGHIR
ELVGEGTFTYDLQTLAGTSGSPVYWIESGQHPVAHLVGVHVAANDNRTNAGCRITQEKLA
WIRSVAAEWGQALGFALGAGGGSRAARALGADGHDDGAYDIGGPIPDAPAAAAQDWRAAR
GLSLSAPEYPQASRFEPAHPGNYRSVPGSRSIERIVIHITDGGPNIAGPVSWFKNPDARV
SAHYIVGQDGEVVQMVAHKDVAWHAGSANSSSIGIEHVANTRGLLPTPQQLAASAALVGW
LCQQYGIPVDRDHILGHAEADTRTTHRGCPNAVWDWDYYMGLVTSRSSYMPTAQGLRSHA
RALEVIQPYYDPSDPHRALACTADAMSREFEEWFVGIDDTRRFPHSAICMLEITGNDGYL
YRGTGFYIGRNRILTCAHNLDDCSQVKISPGLNGAGNAPFGSATVPASSWRIAPGYAGTG
DWANDLAVIENVPIAAPHGLWFEFLQATPAGSMRLAVCGYSSQSDAIPGLTDLIDSHKQH
LHGGTGAYQASLETIDYPILSLRGASGSPVYAVSNEGGTLKAKVCAVHVSGQPADTDNVN
RGCFITPRKIDWIEGRASSFALGAPSRALQAFSVHWTDVPMNYQSSPMSCWAAAASMVAG
WRDQASIPDSEIAAKVPVFDAFNRGLYGHERGYLADAWNLYAEPPASYTVDAWRQMLEAK
GPLYIAQISAAGASSGHVRVLVGMDSDGAPDGSGTTMYLHDPALGPIRQSFAEFVALYEE
RVVTGGEHYQMQVLHSGGAAGRRPGSAAAFALGVHSRAQENDGPSDYPVHLIPQPDKNAC
WAASMAMLLSYRRSQSIAPETIVQEVGGSLATSYGWDLLEAVKSRYGFRTIEMPSNASLY
HAPRQWAQWLQAHGPLWVVIVGAPHAVVVAGIRGNLDDPGATQVKVLNPWDVRVAFDQDP
IAFNPPNNGYEDWIDFSEFASDFGEMAESDYGNWRVLHLPAASAGAQSLSARGGLRLAAP
PPRVVVALETQVGERREPIEPSRVAGTTMARVVGEAGACRWRLDQLEGMKAPATLLPGLS
PATPGDTRIALDDWPAFEASPTPLPLTVEFRHDGAAVGDVRVTAGSPANLAYGVEVAARI
EDCADADGVARLRVRIDYRFHGLAQGNPDATVELALRGDGRYERENGWRNVEQLTSAA
Download sequence
Identical sequences E6WRI0
WP_013534541.1.97407 gi|319786467|ref|YP_004145942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]