SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307150150|ref|YP_003885534.1| from Cyanothece sp. PCC 7822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307150150|ref|YP_003885534.1|
Domain Number 1 Region: 656-890
Classification Level Classification E-value
Superfamily HCP-like 1.91e-50
Family HCP-like 0.0093
Further Details:      
 
Domain Number 2 Region: 534-701
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.88e-34
Family Protein prenylyltransferase 0.0097
Further Details:      
 
Domain Number 3 Region: 27-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.22e-33
Family Prokaryotic proteases 0.0018
Further Details:      
 
Domain Number 4 Region: 260-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.15e-27
Family Prokaryotic proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307150150|ref|YP_003885534.1|
Sequence length 912
Comment peptidase S1 and S6 chymotrypsin/Hap [Cyanothece sp. PCC 7822]
Sequence
MNFLTKPIKLPLIATLTGLILLPTPVVLALTPIAEMRGKIAQLSSESLQKIAQEITVQVL
VKDTRGTGFIVAKKDNTYTVVTNAHVVSRGQPYRIQTSDGQIYQATLKTQGDSFKGYDLA
VLEFQSSKNYPVAAIDNSGNLKNNQEVFAVGFPVESNQLTVIKGNIALVSEKPLAGGYQI
GFNAQTLQGMSGGALLNTEGKVIGVIGMGNLAILDRAYTYKDGTTPDEAIVTQMRQLSFA
VPIANLADMEDNKAANYSGKVAEIDKIAQQVTVRIDSLKSGNGSGVIIAKEGNTYSVLTA
AHVVQNPDNYQVITPDAKGYPITTNAIQIIEGVDLAVVQFQSQQNYQVATLGNYQISLFK
FEEEDIARVFVCGFPASKTGIVKRLLSYGQFVRADLLGSLLGRDVYSFENGYNMIYTNLS
YGGMSGGPVFDLSGQVIGINTASDSEYRNDESGEVVEIPLGFSLGISINTFLSLVNKTPI
NPASLQVKTSPPPTLTQSEQDAFYSQFILNSPPAKANSLDWLIYGLEVLRLNKPQEALKA
IDKAISLKPDFDLAYYAKGLALAFTEQKFEQALVQFDKATQLNPQLEQAWRWKSISLANL
DRHSESLAAIDQSIKLRPKDILLYQFRLFVLFNLENYSEALKTVTQMLALKENNPNGYFW
RGLIYFQQKDYQNSLKDLSKAIEINPNYAEAYGIRGGVYRELQDYQKAITDYNKAIEIQP
DWVEAYNGRGSAYIVLQEPQKAFTDFSKSLEIKQNNPDAYLGLGIFYIAQKNYEKGMDYL
SKTLELKPDYAEAYVIRGKIYVGLEQYQKAITDYSKALEIQQNNAEAYAERGAAYIYLKD
YPKAITDLSKAVELNSNYADAYMARGAVYLVLQEAQKAQGDLQKAAQLYQEQGNTQMYEK
VQQALQNLTKTP
Download sequence
Identical sequences E0UJL5
gi|307150150|ref|YP_003885534.1| WP_013320369.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]