SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003885 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003885
Domain Number 1 Region: 482-821
Classification Level Classification E-value
Superfamily Folate-binding domain 3.14e-85
Family Aminomethyltransferase folate-binding domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 68-289,389-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.07e-57
Family FAD-linked reductases, N-terminal domain 0.0000871
Further Details:      
 
Domain Number 3 Region: 289-388
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-28
Family L-aminoacid/polyamine oxidase 0.0077
Further Details:      
 
Domain Number 4 Region: 823-917
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 5.56e-17
Family Aminomethyltransferase beta-barrel domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003885   Gene: ENSSTOG00000004316   Transcript: ENSSTOT00000004330
Sequence length 919
Comment pep:known_by_projection scaffold:spetri2:JH393479.1:3244254:3298110:1 gene:ENSSTOG00000004316 transcript:ENSSTOT00000004330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRVATTCPRKRPAQGLQLQPLASVAGPTTEKNVPYQRTLKEEAQGPSTAARGP
SQPLPSTADVVVIGGGSLGCQTLYHLAKLGVSGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVES
HVLSPAETKALYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLVRAAAARGAQVIENCPVTG
IRVRTDDFGVRRVAAVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTE
RIEGIQNMPNVRDHDASVYLRLQGDALSVGGYENNPVFWEEVSDKFAFGLFDLDWDVFSQ
HIEGAINRVPVLERTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGG
CGQELAHWIIHGRPEKDMYGYDIRRFHHSLTDHSRWIRERSHESYAKNYSVVFPHDEPLA
GRNMRTDALHQELLEQGCVFQERHGWERPGWFSPQGTAPVPDYDYYGAYGNQVHQDCAYT
RLLEDEYTFEFPPHHGVIQKECLTCRGAAAVFNMSYFGKFYLLGLDASKAADWLFSADVS
RPPGSTVYTCMLNQRGGAESDLTVSRLAPGPEAGPLAPAFEGDGYYLAVGGAAAQHNWSH
ISTVLQDQKFRCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNSAFPFSTHQLVRAAG
HLVRAMRLSFVGELGWELHIPRASCVPVYRAVMTAGAKHGLVNAGYRAIDSLSIEKGYRH
WHADLRSDDSPLEAGLAFTCKLKSRVPFLGREALERQREAGLRRRLVCLTVEEKVPMFGL
EAIWRNGQVVGHVRRADFGFTLDKTIAYGYIQNPSGGPVSLDFVKSGDYALERMGVTYAA
QVHLKSPFDPDNKRVRGIY
Download sequence
Identical sequences I3M413
ENSSTOP00000003885 ENSSTOP00000003885 XP_021590045.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]