SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSTOP00000007704 from Ictidomys tridecemlineatus 73_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007704
Domain Number 1 Region: 287-479
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-63
Family Hemopexin-like domain 3.39e-06
Further Details:      
 
Domain Number 2 Region: 110-274
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.1e-56
Family Matrix metalloproteases, catalytic domain 1e-06
Further Details:      
 
Domain Number 3 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 1.51e-19
Family MMP N-terminal domain 0.0009
Further Details:      
 

Protein sequence

External link(s) Protein: ENSSTOP00000007704   Gene: ENSSTOG00000008600   Transcript: ENSSTOT00000008596
Sequence length 479
Comment pep:novel scaffold:spetri2:JH393361.1:5106285:5117843:1 gene:ENSSTOG00000008600 transcript:ENSSTOT00000008596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFWREKLTMKLLLLILVLWVTELGAASQAKVISPTEMDEEFAEMYLNHFYGLTETIPMTK
MKISRDSLKEKIQEMQKFFGLNVTGQLDTSTLEVMHKPRCGVPDVHHYSTFQGRPVWKKH
EITYRINNYTPDMKKEDVDYAIQKAFQVWSDVTPLKFRRVHAGEADIMISFANGEKAHGD
FNPFDGKDGILAHAYEPGPGIGGDAHFDEAETWSKNQQGRNLFLVAVHELGHSLGLGHSN
DRKAIMYPNYGYLDPNTFHLSSDDIRGIQSLYGGPEKHQPMPNPDRPKPAVCDPNLSFDA
VTTLGDKIIFFKDGVFWWKFPETSKTGISSISSLWPTLPSGIQAAYEIEARKQVFLFKDD
KYWLLSNLRLQPNYPKSIYSLGFPKYVKKIDGAVFNPLLYKTYFFVNSWYWRYDERNQRM
DPGYPRQITKNFPGIGPKIDAVFYFKRNYYFFQGSTQLQYDVMLHRVTKRLRSSNWFGC
Download sequence
Identical sequences I3MBX4
ENSSTOP00000007704 ENSSTOP00000007704

Jump to [ Top of page · Domain architecture · Domain assignment details ]