SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSTOP00000007704 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007704
Domain Number 1 Region: 287-479
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-63
Family Hemopexin-like domain 0.00000339
Further Details:      
 
Domain Number 2 Region: 110-274
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.1e-56
Family Matrix metalloproteases, catalytic domain 0.000001
Further Details:      
 
Domain Number 3 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 1.51e-19
Family MMP N-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
clathrin-coated vesicle 1.876 7.78
coated vesicle 1.74 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
growth factor receptor binding 1.997 15.08
cytokine receptor binding 2.035 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07

Protein sequence

External link(s) Protein: ENSSTOP00000007704   Gene: ENSSTOG00000008600   Transcript: ENSSTOT00000008596
Sequence length 479
Comment pep:known_by_projection scaffold:spetri2:JH393361.1:5106285:5117843:1 gene:ENSSTOG00000008600 transcript:ENSSTOT00000008596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFWREKLTMKLLLLILVLWVTELGAASQAKVISPTEMDEEFAEMYLNHFYGLTETIPMTK
MKISRDSLKEKIQEMQKFFGLNVTGQLDTSTLEVMHKPRCGVPDVHHYSTFQGRPVWKKH
EITYRINNYTPDMKKEDVDYAIQKAFQVWSDVTPLKFRRVHAGEADIMISFANGEKAHGD
FNPFDGKDGILAHAYEPGPGIGGDAHFDEAETWSKNQQGRNLFLVAVHELGHSLGLGHSN
DRKAIMYPNYGYLDPNTFHLSSDDIRGIQSLYGGPEKHQPMPNPDRPKPAVCDPNLSFDA
VTTLGDKIIFFKDGVFWWKFPETSKTGISSISSLWPTLPSGIQAAYEIEARKQVFLFKDD
KYWLLSNLRLQPNYPKSIYSLGFPKYVKKIDGAVFNPLLYKTYFFVNSWYWRYDERNQRM
DPGYPRQITKNFPGIGPKIDAVFYFKRNYYFFQGSTQLQYDVMLHRVTKRLRSSNWFGC
Download sequence
Identical sequences I3MBX4
ENSSTOP00000007704 ENSSTOP00000007704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]