SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0150177 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0150177
Domain Number 1 Region: 1146-1388
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.35e-67
Family Eukaryotic proteases 0.0021
Further Details:      
 
Domain Number 2 Region: 2058-2201
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000564
Family Eukaryotic proteases 0.0027
Further Details:      
 
Domain Number 3 Region: 2439-2476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 907-943
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000838
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 2325-2360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 6 Region: 1795-1832
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 2368-2402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 8 Region: 1405-1439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 9 Region: 1729-1765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0150177
Domain Number - Region: 995-1020
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 2406-2437
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0209
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number - Region: 950-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0288
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number - Region: 1774-1792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0288
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 1856-1904
Classification Level Classification E-value
Superfamily SRCR-like 0.085
Family Hepsin, N-terminal domain 0.071
Further Details:      
 
Domain Number - Region: 1035-1119
Classification Level Classification E-value
Superfamily SRCR-like 0.0994
Family Hepsin, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0150177   Gene: FBgn0123742   Transcript: FBtr0151685
Sequence length 2634
Comment type=protein; loc=scaffold_15110:join(8361432..8361567,8361629..8363500,8363564..8364642,8364701..8365177,8365238..8365571,8365629..8366937,8367184..8367353,8367409..8367522,8367582..8368371,8368436..8368627,8368687..8369156,8369274..8369565,8369621..8369728,8369786..8370347); ID=FBpp0150177; name=DgriGH16271-PA; parent=FBgn0123742,FBtr0151685; dbxref=GB_protein:EDV96489,FlyBase:FBpp0150177,FlyBase_Annotation_IDs:GH16271-PA,REFSEQ:XP_001984141,FlyMine:FBpp0150177; MD5=be50429bdc1e0011d14c0b313786f3be; length=2634; release=r1.3; species=Dgri;
Sequence
MRFHRIPRRNCFPRLPCTRILIISVLVLITLLVSLIYHGIVLERMDHLRQLMALNRKHAR
HMQPFNENDAFVISPQPQPFRIQLMNDDATMAVATKSEEKALRLKHLRFKFRMKRRFRPR
RSIQSVDLLDPLQLELKMQHLYTKLRNKRAKAALSQLENEYVRCKVQTPEDCMLAFMRMY
KMAKEITEKMDKMKEIIKDHLESSSMESQDSESDAPAKTKTKKTTVPPLEELTTSTSSDE
ETTLKPTRVKITPAKISWIIDGHGHDEQEAYVENTPRALTTTELDYGTTTTLATTTVEST
TLTTTVESSTFTTTAESTTATTTVGNTTPTTTVDSTIPTTTTVSTATSSSNSNSSFTATT
TTGNHLLVHTTEGPDVDDIIDPITWFLDRFDKPKEIRRTTVPTNEKATTIEITTEVQQTT
TLPSFDFKSGPLHSDDHMTNASFHSTTTELTTDAPAPLTTTTNTAESETLPRKLQHDWIL
DVEEQEVEPIVHPVTTPPIISTTFSPSTSTDVVDAANQTAIPTKLKPIKFSWIIDGDDGS
IEERITTQVAGTTETSTDTRTETTIESTTESARAMHPLDNPSSIENMLDSSERHGQEKPL
IKVLPAKNETTLPENSKNDSVYDRNHWLHQFEQQASQDELIETFGTEQDVKSLQQLGPKL
NPASGKQLNAADAQLMTICAHISRKLRQQAASEVASTESDTFTASPSVQFTSRAPGGFPV
SGETMKASAQFMFNPNFGMPSIPVCFYMTPANFRMPMWSPTPTFMGMQAGHFGGSSNAGG
IFFVPQQTFGPSANFFGGSGGTAGGGGAQNQLPNIFSKNASPLKQGGNGQQQQVYCTYMQ
NQQGHAQSQGQSIQGNLSPGSQAGFSNANFKMRHGANQTSGPQQSQIIYASYVGEPQQPL
ERFKCPEADQSACYGQKQCIPTSRWCDNVVDCSDGSDESACTCADRLDEDRLCDGYADCP
MGEDELGCFGCESLAHSCYENAEEYARHNRSKLSMCYSRLERCDGFRNCFNGRDELQCSM
LITDVTHHMSHAATSSEGYLFHNHRGDWYPVCNNGAKWASDACELQELNQTTNVTFKELT
LTGPFIEPSLHAGIHFAQACHGRNDQDTLVNHVAYVKCPSPQCGLPSKPSQSENKKRTRR
APIEDRTDAAKTRIVGGSYATQLQWPFVVAIYRDGNFHCGGTIYSEHWIISAAHCVINFG
KYYYEVRAGLLRRTSYSPATQIQTVSHVVVHQAYERRTMRNDLSLVRVAAPLQFNRWVKP
ICMPDMGRTTFGQDWIWGPEEHTLCTVVGWGAIREKGPSSDPMRQVILPIRKGCTDPEDR
ASEDVCAGEPDGGRDACQGDSGGPLFCRSVSQPDQWYLAGVVSHGNGCARPKEFGVYTRV
ALYLDWLELAVEPHLLPARQPLQLCPGFLCVWGGKRCIAQRKRCDRNVDCLGGEDEVGCA
YNFIPDMVGTSKQNISSTTESDYHPPTIRKNVPQDQEAQQTESKQRQDVSLEDANLSAEI
MKVPPAESETGQINATTIIATTESDDLKTTGENSKEITQTETELELTTATSSETTTTLQK
DSLQTTTTGPSTLPTTWPTSTEDFMKLTDLINQLLEESTTIATTSGEGLANTTLFTFTTD
APSLATTTITTLATVAETTTTDVETTTFMTPTTGDNTTTDSVKTTITLPTTTTLPTAKAP
TTTTTTMQTTTTRTTTTPPTTTTPPTTTTRTNSIPTTKSSKGISKPQLPDKFICQKMPQI
VDMLHRCDRNVDCEDGTDELDCTCREYLKGRLSVLICDGKADCEDLSDEKDCGGCQENEY
HCALSKTCLPLAKRCDNIVDCKFNEDEKDCFALTNGHDVHFDAHQQPKFSSVGIFSKNAH
GLWRVVCAHETGFHEHQAKTADTVCALLGFKGAHHYNSTEFVNQQEMHPITPELAKKSQS
GSELQTLMRDNGQLSSGERRLPLDIPHMLLGQHKAHVLADKCVGIYVECNPRSNATLPMK
TFSAGQPIKHRPSEHLPELLPTIETHKRPNVHFKPQLPAQLVNKKDEIMDRLDMLIKSKN
NKTLLVQDQLHEAIEDLHWPWLADVYANGELWCLGVLLDKHWLLVHESCLSGISFETHYI
STLLGGGKTKHSLHRSTHEQVRRVDCFEAVPKSNVLLYHLEQPARFTHYVLPTFLPDISS
EKESPPHECIGVLQDDYTGRIKTVAITEIKNDTSCISCYQLQQRQPSGNLMRMLNVSAED
MASISEEVELVSGVTAREMPALTKFTSCTQFGQKNHTDAQVSPSNQGVLVCRDSHTGWFP
TALFSYNNTNCQSFNTPFGIRTLEQAYKSLQDIMDQPHCSNVQSMPPCTTHRCPLGTCLE
QTALCDGHSDCHDGSDEVESKCRELKQRCAPGEMKCRTSSKCVAKSKFCDHVPDCEDMTD
EPTICSCFTYLQATDPSKICDGKRNCWDKSDESSVLCNCTADHFQCSSSPEDCIPRDFVC
DKQPDCPNGEDERFCFGIEQPLHEQQDDYWSHSGHSHKATVSKYGQVIEQSYGIWHTKCF
PKSSPPSVAEVRDICKKLGYHPDRMPSYRLIDDTTNEAKHTFEVADHLGRSFSNDSLVGK
YRESTKAVIISKFSPLELNERLTLFLKPSRSIAELVRWNTTDSNRCFRLEIRCA
Download sequence
Identical sequences B4IXW8
FBpp0150177 7222.FBpp0150177 XP_001984141.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]