SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0151661 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151661
Domain Number 1 Region: 530-834
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.99e-73
Family FMN-linked oxidoreductases 5.67e-10
Further Details:      
 
Domain Number 2 Region: 9-196
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 4.34e-36
Family Dihydropyrimidine dehydrogenase, N-terminal domain 5.27e-07
Further Details:      
 
Domain Number 3 Region: 186-439
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.69e-33
Family N-terminal domain of adrenodoxin reductase-like 4.12e-05
Further Details:      
 
Domain Number 4 Region: 53-103,919-1011
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.36e-26
Family Ferredoxin domains from multidomain proteins 9.28e-05
Further Details:      
 
Weak hits

Sequence:  FBpp0151661
Domain Number - Region: 415-498
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0118
Family N-terminal domain of adrenodoxin reductase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
respiratory chain 2.14 21.17
mitochondrial membrane part 1.917 20.85
organelle inner membrane 1.672 15.15
mitochondrial envelope 1.57 13.6
microbody 1.955 12.91
external encapsulating structure 1.632 12.22
mitochondrial inner membrane 1.751 9.3
mitochondrial intermembrane space 2.197 6.32
cytosol 1.305 4.5

Protein sequence

External link(s) Protein: FBpp0151661   Gene: FBgn0125225   Transcript: FBtr0153169
Sequence length 1033
Comment type=protein; loc=scaffold_15081:join(87941..87985,88109..88864,89115..91163,91237..91394,91469..91562); ID=FBpp0151661; name=DgriGH17755-PA; parent=FBgn0125225,FBtr0153169; dbxref=FlyBase:FBpp0151661,FlyBase_Annotation_IDs:GH17755-PA,GB_protein:EDV95106,REFSEQ:XP_001995454,FlyMine:FBpp0151661; MD5=d0ccd1ca152a1fc21eb89f3223f5f121; length=1033; release=r1.3; species=Dgri;
Sequence
MSPPAMLSKDAPDIEDLLALNPRVKTQCSVVPTKQTKDNKKHWKRNVDHTAVPCTTLSNN
FEDIKHTTLSERGALEESARCLKCADAPCQKSCPTQLDIKSFITSIANKNYYGAAKAIFS
DNPLGLTCGMVCPTSDLCVGGCNLQASEIGPINIGGLQQFATEAFKKMGVHQRRSPALKP
LAQPAKKIALLGGGPASLSCATYLGRLGYNDITIYERRRYLGGLSSAEIPQYRLPIDVVN
FEIDLVKDLGVKFELNRALSSKDLTINGLLSSGHDAIFVGIGLPEPKLEPMFNGLNTQSG
FYTSKNFLPMVSDGSKPGLCACKSAQSLPKLYGNVIVLGAGDTAFDCATSALRCGARRVF
VVFRKGSSGIRAVPEEVELAREERCELMPYLSPRKVIVKDGHIAAMEFCRTEQNDQDEWV
EDEEQLVRLKANFVISAFGSGLQDAEVKVALTPLTFRNGLPVVDRTTMQSSVPQVFLGGD
LGGVANTTVESVNDGKVAAWSIHCQLQGLPLDTPAALPLFHTDIDNVDISVEMCGLKFEN
PFGLASAPPTTSAAMIRRAFEQGWGFVVTKTFGLDKDMVTNVSPRIVRGTTSGYRYGPQQ
NCFLNIELISEKLAEYWLRSIGELKRDFPEKIIIASIMCSYNEADWTELATKAEASGADA
LELNLSCPHGMGESGMGLACGQEPKLVMDISRWVRKAVKVPFFIKLTPNITDIVSIARAA
QLGGADGGSAINTVQGLMSLKADATAWPAIGKEQRTTYGGVSGNATRPMALRAVSEIAKK
LPGFAILGIGGIDSGEVALQFLQAGATVLQICSSVQNQDFTLIDDYCTSLKTLLYLKANP
PPVNGTFWDGQSPPTPVHQKGKPVIHLTGTGNQTLGYFGPYQKQRDIKLADLRRLEGAFW
DARQASAASSSDASIKLAPKVSDVIGAALPMIGAYKSLDNTQQKVALINDDMCINCGKCY
MTCADSGYQAIEFDKNTHLPHVNDDCTGCTLCVSVCPIIDCIRMEPKQIPHIIKRGVEEK
DKTFYTHALSPSQ
Download sequence
Identical sequences B4JXK7
FBpp0151661 7222.FBpp0151661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]