SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0151661 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151661
Domain Number 1 Region: 530-834
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.99e-73
Family FMN-linked oxidoreductases 5.67e-10
Further Details:      
 
Domain Number 2 Region: 9-196
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 4.34e-36
Family Dihydropyrimidine dehydrogenase, N-terminal domain 5.27e-07
Further Details:      
 
Domain Number 3 Region: 186-439
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.69e-33
Family N-terminal domain of adrenodoxin reductase-like 4.12e-05
Further Details:      
 
Domain Number 4 Region: 53-103,919-1011
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.36e-26
Family Ferredoxin domains from multidomain proteins 9.28e-05
Further Details:      
 
Weak hits

Sequence:  FBpp0151661
Domain Number - Region: 415-498
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0118
Family N-terminal domain of adrenodoxin reductase-like 0.0022
Further Details:      
 

Protein sequence

External link(s) Protein: FBpp0151661   Gene: FBgn0125225   Transcript: FBtr0153169
Sequence length 1033
Comment type=protein; loc=scaffold_15081:join(87941..87985,88109..88864,89115..91163,91237..91394,91469..91562); ID=FBpp0151661; name=DgriGH17755-PA; parent=FBgn0125225,FBtr0153169; dbxref=FlyBase:FBpp0151661,FlyBase_Annotation_IDs:GH17755-PA,GB_protein:EDV95106,REFSEQ:XP_001995454,FlyMine:FBpp0151661; MD5=d0ccd1ca152a1fc21eb89f3223f5f121; length=1033; release=r1.3; species=Dgri;
Sequence
MSPPAMLSKDAPDIEDLLALNPRVKTQCSVVPTKQTKDNKKHWKRNVDHTAVPCTTLSNN
FEDIKHTTLSERGALEESARCLKCADAPCQKSCPTQLDIKSFITSIANKNYYGAAKAIFS
DNPLGLTCGMVCPTSDLCVGGCNLQASEIGPINIGGLQQFATEAFKKMGVHQRRSPALKP
LAQPAKKIALLGGGPASLSCATYLGRLGYNDITIYERRRYLGGLSSAEIPQYRLPIDVVN
FEIDLVKDLGVKFELNRALSSKDLTINGLLSSGHDAIFVGIGLPEPKLEPMFNGLNTQSG
FYTSKNFLPMVSDGSKPGLCACKSAQSLPKLYGNVIVLGAGDTAFDCATSALRCGARRVF
VVFRKGSSGIRAVPEEVELAREERCELMPYLSPRKVIVKDGHIAAMEFCRTEQNDQDEWV
EDEEQLVRLKANFVISAFGSGLQDAEVKVALTPLTFRNGLPVVDRTTMQSSVPQVFLGGD
LGGVANTTVESVNDGKVAAWSIHCQLQGLPLDTPAALPLFHTDIDNVDISVEMCGLKFEN
PFGLASAPPTTSAAMIRRAFEQGWGFVVTKTFGLDKDMVTNVSPRIVRGTTSGYRYGPQQ
NCFLNIELISEKLAEYWLRSIGELKRDFPEKIIIASIMCSYNEADWTELATKAEASGADA
LELNLSCPHGMGESGMGLACGQEPKLVMDISRWVRKAVKVPFFIKLTPNITDIVSIARAA
QLGGADGGSAINTVQGLMSLKADATAWPAIGKEQRTTYGGVSGNATRPMALRAVSEIAKK
LPGFAILGIGGIDSGEVALQFLQAGATVLQICSSVQNQDFTLIDDYCTSLKTLLYLKANP
PPVNGTFWDGQSPPTPVHQKGKPVIHLTGTGNQTLGYFGPYQKQRDIKLADLRRLEGAFW
DARQASAASSSDASIKLAPKVSDVIGAALPMIGAYKSLDNTQQKVALINDDMCINCGKCY
MTCADSGYQAIEFDKNTHLPHVNDDCTGCTLCVSVCPIIDCIRMEPKQIPHIIKRGVEEK
DKTFYTHALSPSQ
Download sequence
Identical sequences B4JXK7
FBpp0151661 7222.FBpp0151661

Jump to [ Top of page · Domain architecture · Domain assignment details ]