SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|Q75EC2|Q75EC2_ASHGO from Ashbya gossypii ATCC 10895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|Q75EC2|Q75EC2_ASHGO
Domain Number 1 Region: 128-238
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 3.53e-23
Family Siroheme synthase middle domains-like 0.00033
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000486
Family Siroheme synthase N-terminal domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|Q75EC2|Q75EC2_ASHGO
Sequence length 262
Comment AAR152Wp OS=Ashbya gossypii GN=AAR152W
Sequence
MLSLPLAHQMGGRHVLLVGCGAVGMTRVDKLVPTGCKLTVVAPEVDAGLAAYMPGGMEVA
AGATWVNKGWEPGQVYRVARREFAAGDEGLEAFAFVLACVPAGGLGARVHALSHARGVQC
NVADVPALCDFYFGSQCALGERGLQVLVSSNGAAPRLTALLRADIERRYAALDWDEMCGR
LRALRERARALSTQAGLPAEEALRFRMDWMRQVTDAFGLEHCAAMDVERLAGLFGEMAAA
AAAGRPRALPADLVSVYTESST
Download sequence
Identical sequences Q75EC2
tr|Q75EC2|Q75EC2_ASHGO NP_982695.1.49492 33169.AGOS_AAR152W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]