SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCPOP00000000194 from Cavia porcellus 73_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000194
Domain Number 1 Region: 262-455
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.23e-69
Family Hemopexin-like domain 5.68e-09
Further Details:      
 
Domain Number 2 Region: 90-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.6e-60
Family Matrix metalloproteases, catalytic domain 6.69e-08
Further Details:      
 
Domain Number 3 Region: 14-85
Classification Level Classification E-value
Superfamily PGBD-like 1.08e-19
Family MMP N-terminal domain 0.00065
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCPOP00000000194   Gene: ENSCPOG00000000221   Transcript: ENSCPOT00000000224
Sequence length 455
Comment pep:novel scaffold:cavPor3:scaffold_19:7049452:7059163:-1 gene:ENSCPOG00000000221 transcript:ENSCPOT00000000224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSLPLPSAEDEEDLSEEDLQFAERYLKSYYHPVNLAGILKKSAGSSMVDRLREMQSFFG
LEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMAPSEVEK
AFKKAFKVWSSVTPLNFTRLHEGTADIMISFGTKEHGDYYPFDGPSGLLAHAFPPGPNYG
GDAHFDDDEYWTDSSKGYNLFLVAAHELGHSLGLEHSRDPGALMFPVYTYTDKSHFVLPD
DDVQGIQSLYGPGDEDPNPKHPKTPDKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQV
DAELFLTKSFWPELPNRIDAAYEHPSRDRIFIFRGRKFWALNGYDIVEGYPKKIAELGFP
KEIKRLSAAVHLEDSGKTLFFSGNQVWRYDDINHVMDEDYPRLIEEVFPGIGDKVDAVYE
NNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSLLWC
Download sequence
Identical sequences H0UTG1
10141.ENSCPOP00000000194 ENSCPOP00000000194 ENSCPOP00000000194

Jump to [ Top of page · Domain architecture · Domain assignment details ]