SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSCPOP00000000194 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000194
Domain Number 1 Region: 262-455
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.23e-69
Family Hemopexin-like domain 0.00000000568
Further Details:      
 
Domain Number 2 Region: 90-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.6e-60
Family Matrix metalloproteases, catalytic domain 0.0000000669
Further Details:      
 
Domain Number 3 Region: 14-85
Classification Level Classification E-value
Superfamily PGBD-like 1.08e-19
Family MMP N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07

Protein sequence

External link(s) Protein: ENSCPOP00000000194   Gene: ENSCPOG00000000221   Transcript: ENSCPOT00000000224
Sequence length 455
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:7049452:7059163:-1 gene:ENSCPOG00000000221 transcript:ENSCPOT00000000224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSLPLPSAEDEEDLSEEDLQFAERYLKSYYHPVNLAGILKKSAGSSMVDRLREMQSFFG
LEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMAPSEVEK
AFKKAFKVWSSVTPLNFTRLHEGTADIMISFGTKEHGDYYPFDGPSGLLAHAFPPGPNYG
GDAHFDDDEYWTDSSKGYNLFLVAAHELGHSLGLEHSRDPGALMFPVYTYTDKSHFVLPD
DDVQGIQSLYGPGDEDPNPKHPKTPDKCDPALSLDAITSLRGETMIFKDRFFWRLHPQQV
DAELFLTKSFWPELPNRIDAAYEHPSRDRIFIFRGRKFWALNGYDIVEGYPKKIAELGFP
KEIKRLSAAVHLEDSGKTLFFSGNQVWRYDDINHVMDEDYPRLIEEVFPGIGDKVDAVYE
NNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSLLWC
Download sequence
Identical sequences H0UTG1
10141.ENSCPOP00000000194 ENSCPOP00000000194 ENSCPOP00000000194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]