SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCPOP00000017905 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017905
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-69
Family Hemopexin-like domain 1.06e-05
Further Details:      
 
Domain Number 2 Region: 110-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-55
Family Matrix metalloproteases, catalytic domain 2.56e-08
Further Details:      
 
Domain Number 3 Region: 19-93
Classification Level Classification E-value
Superfamily PGBD-like 1.52e-20
Family MMP N-terminal domain 0.0039
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.68
endopeptidase activity 1.539 149.06
zinc ion binding 1.658 43.63
integrin binding 1.752 16.89
cytokine receptor binding 2.034 15.07
growth factor receptor binding 1.996 15.07
enzyme activator activity 1.402 14.46
amide binding 1.714 13.22
collagen binding 1.837 10.42
protein complex binding 1.49 7.68
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.15 9.58
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.9
clathrin-coated vesicle 1.877 7.9
dendrite 1.544 7.13
synapse part 1.52 5.81
Biological Process IC (bits) H-Score
multicellular organismal macromolecule metabolic process 2.096 51.92
response to light stimulus 1.445 44.78
regulation of cytokine production 1.55 43.33
protein processing 1.807 42.16
proteolysis 1.342 38.76
peptide metabolic process 1.567 38.1
regulation of systemic arterial blood pressure 1.951 27.4
multi-organism behavior 1.851 26.92
interspecies interaction between organisms 1.592 26.41
modification by symbiont of host morphology or physiology 2.008 26.41

Protein sequence

External link(s) Protein: ENSCPOP00000017905   Gene: ENSCPOG00000024551   Transcript: ENSCPOT00000022619
Sequence length 579
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:17917425:17925611:-1 gene:ENSCPOG00000024551 transcript:ENSCPOT00000022619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPRSLLLPLLTLGTALASLGLTQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAI
AAMQKFYGLPVTGIADADTMRAMMRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEIT
FCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGF
HGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHAL
GLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGLPTKMPPRPRTTSRPSV
PDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLP
ASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPNG
KTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPDSPRGSFMGSDEVFTYFYKGNKYWK
FNNQKLKVEPGYPKSALRDWMGCPSGGQPDQPDQGTEKTEVIIIEVEEEGSGAVNAAAVV
LPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences H0W4K4
10141.ENSCPOP00000017905 ENSCPOP00000017905 ENSCPOP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]