SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCPOP00000017905 from Cavia porcellus 73_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017905
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-69
Family Hemopexin-like domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 110-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-55
Family Matrix metalloproteases, catalytic domain 0.0000000256
Further Details:      
 
Domain Number 3 Region: 19-93
Classification Level Classification E-value
Superfamily PGBD-like 1.52e-20
Family MMP N-terminal domain 0.0039
Further Details:      
 

Protein sequence

External link(s) Protein: ENSCPOP00000017905   Gene: ENSCPOG00000024551   Transcript: ENSCPOT00000022619
Sequence length 579
Comment pep:novel scaffold:cavPor3:scaffold_13:17917425:17925611:-1 gene:ENSCPOG00000024551 transcript:ENSCPOT00000022619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPRSLLLPLLTLGTALASLGLTQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAI
AAMQKFYGLPVTGIADADTMRAMMRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEIT
FCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGF
HGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHAL
GLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGLPTKMPPRPRTTSRPSV
PDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLP
ASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPNG
KTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPDSPRGSFMGSDEVFTYFYKGNKYWK
FNNQKLKVEPGYPKSALRDWMGCPSGGQPDQPDQGTEKTEVIIIEVEEEGSGAVNAAAVV
LPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences H0W4K4
10141.ENSCPOP00000017905 ENSCPOP00000017905 ENSCPOP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details ]