SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017905 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017905
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-69
Family Hemopexin-like domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 110-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-55
Family Matrix metalloproteases, catalytic domain 0.0000000256
Further Details:      
 
Domain Number 3 Region: 19-93
Classification Level Classification E-value
Superfamily PGBD-like 1.52e-20
Family MMP N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96
Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05

Protein sequence

External link(s) Protein: ENSCPOP00000017905   Gene: ENSCPOG00000024551   Transcript: ENSCPOT00000022619
Sequence length 579
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:17917425:17925611:-1 gene:ENSCPOG00000024551 transcript:ENSCPOT00000022619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPRSLLLPLLTLGTALASLGLTQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAI
AAMQKFYGLPVTGIADADTMRAMMRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEIT
FCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGF
HGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHAL
GLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGLPTKMPPRPRTTSRPSV
PDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLP
ASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPNG
KTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPDSPRGSFMGSDEVFTYFYKGNKYWK
FNNQKLKVEPGYPKSALRDWMGCPSGGQPDQPDQGTEKTEVIIIEVEEEGSGAVNAAAVV
LPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences H0W4K4
ENSCPOP00000017905 10141.ENSCPOP00000017905 ENSCPOP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]