SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSCPOP00000017905 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017905
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-69
Family Hemopexin-like domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 110-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-55
Family Matrix metalloproteases, catalytic domain 0.0000000256
Further Details:      
 
Domain Number 3 Region: 19-93
Classification Level Classification E-value
Superfamily PGBD-like 1.52e-20
Family MMP N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSCPOP00000017905   Gene: ENSCPOG00000024551   Transcript: ENSCPOT00000022619
Sequence length 579
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:17917425:17925611:-1 gene:ENSCPOG00000024551 transcript:ENSCPOT00000022619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPRSLLLPLLTLGTALASLGLTQSSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAI
AAMQKFYGLPVTGIADADTMRAMMRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEIT
FCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGF
HGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHAL
GLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGLPTKMPPRPRTTSRPSV
PDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLP
ASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPNG
KTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPDSPRGSFMGSDEVFTYFYKGNKYWK
FNNQKLKVEPGYPKSALRDWMGCPSGGQPDQPDQGTEKTEVIIIEVEEEGSGAVNAAAVV
LPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences H0W4K4
ENSCPOP00000017905 ENSCPOP00000017905 10141.ENSCPOP00000017905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]