SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0241276 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0241276
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.22e-100
Family Tubulin, GTPase domain 0.000000000375
Further Details:      
 
Domain Number 2 Region: 244-429
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.32e-84
Family Tubulin, C-terminal domain 0.00000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
GTPase activity 2.078 11.98
purine ribonucleoside binding 1.983 11.75
guanyl ribonucleotide binding 1.991 11.17
Biological Process IC (bits) H-Score
plant epidermis development 2.228 37.65
microtubule-based process 1.533 36.29
unidimensional cell growth 2.174 35.93
cell growth 1.639 27.24
female gamete generation 1.494 25.88
meiotic cell cycle process 2.001 25.88
nuclear division 1.882 25.88
fruit development 2.075 25.66
microtubule-based movement 2.007 25.65
developmental growth involved in morphogenesis 1.583 21.78
Cellular Component IC (bits) H-Score
polymeric cytoskeletal fiber 1.651 47.95
cytoplasmic microtubule 2.128 27.04
microtubule cytoskeleton 1.399 6.44
outer membrane 2.082 6.27
plastid 1.489 5.54
thylakoid 2.149 5.54
chloroplast stroma 1.979 5.54
spindle microtubule 2.192 4.95
mitochondrial envelope 1.596 3.96

Protein sequence

External link(s) Protein: FBpp0241276   Gene: FBgn0214144   Transcript: FBtr0242784
Sequence length 446
Comment type=protein; loc=scf2_1100000004902:join(9769916..9770308,9770368..9771315); ID=FBpp0241276; name=DwilGK12133-PA; parent=FBgn0214144,FBtr0242784; dbxref=FlyBase:FBpp0241276,FlyBase_Annotation_IDs:GK12133-PA,GB_protein:EDW81561,REFSEQ:XP_002070575; MD5=0aa0b500c2b326a8676660072c521f73; length=446; release=r1.3; species=Dwil;
Sequence
MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYV
PRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEEGEFDEDEEGGGDE
Download sequence
Identical sequences B0ZPS8 B3M059 B3NZS6 B4HKE0 B4JEL1 B4K4Z6 B4LW18 B4N8W0 B4PUN3 B4QWM7 C7SAG2 C7SAG3 C7SAG4 P61857 P61858 Q29BM0 Q3BD74 Q3BDH7
FBpp0120957 7217.FBpp0120957 7222.FBpp0153048 7227.FBpp0081524 7237.FBpp0283262 7244.FBpp0237990 7245.FBpp0269789 7260.FBpp0241276 FBpp0207737 FBpp0135920 FBpp0081524 FBpp0153048 FBpp0237990 FBpp0241276 FBpp0081524 FBpp0269789 FBpp0219200 FBpp0081524 FBpp0283262 FBpp0172816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]