SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for FBpp0241276 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0241276
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.22e-100
Family Tubulin, GTPase domain 3.75e-10
Further Details:      
 
Domain Number 2 Region: 244-429
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.32e-84
Family Tubulin, C-terminal domain 7.17e-09
Further Details:      
 

Protein sequence

External link(s) Protein: FBpp0241276   Gene: FBgn0214144   Transcript: FBtr0242784
Sequence length 446
Comment type=protein; loc=scf2_1100000004902:join(9769916..9770308,9770368..9771315); ID=FBpp0241276; name=DwilGK12133-PA; parent=FBgn0214144,FBtr0242784; dbxref=FlyBase:FBpp0241276,FlyBase_Annotation_IDs:GK12133-PA,GB_protein:EDW81561,REFSEQ:XP_002070575; MD5=0aa0b500c2b326a8676660072c521f73; length=446; release=r1.3; species=Dwil;
Sequence
MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYV
PRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEEGEFDEDEEGGGDE
Download sequence
Identical sequences B0ZPS8 B3M059 B3NZS6 B4HKE0 B4JEL1 B4K4Z6 B4LW18 B4N8W0 B4PUN3 B4QWM7 C7SAG2 C7SAG3 C7SAG4 P61857 P61858 Q29BM0 Q3BD74 Q3BDH7
FBpp0081524 FBpp0207737 FBpp0241276 7217.FBpp0120957 7222.FBpp0153048 7227.FBpp0081524 7237.FBpp0283262 7244.FBpp0237990 7245.FBpp0269789 7260.FBpp0241276 FBpp0237990 FBpp0219200 FBpp0283262 FBpp0081524 FBpp0172816 FBpp0153048 FBpp0081524 FBpp0269789 FBpp0120957 FBpp0135920

Jump to [ Top of page · Domain architecture · Domain assignment details ]