SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0241276 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0241276
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.22e-100
Family Tubulin, GTPase domain 0.000000000375
Further Details:      
 
Domain Number 2 Region: 244-429
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.32e-84
Family Tubulin, C-terminal domain 0.00000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0241276   Gene: FBgn0214144   Transcript: FBtr0242784
Sequence length 446
Comment type=protein; loc=scf2_1100000004902:join(9769916..9770308,9770368..9771315); ID=FBpp0241276; name=DwilGK12133-PA; parent=FBgn0214144,FBtr0242784; dbxref=FlyBase:FBpp0241276,FlyBase_Annotation_IDs:GK12133-PA,GB_protein:EDW81561,REFSEQ:XP_002070575; MD5=0aa0b500c2b326a8676660072c521f73; length=446; release=r1.3; species=Dwil;
Sequence
MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYV
PRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEEGEFDEDEEGGGDE
Download sequence
Identical sequences A0A0A1X705 A0A0K8V1H9 A0A0M4EPH2 A0A1I8NIF8 A0A1W4VQL1 B0ZPS8 B3M059 B3NZS6 B4HKE0 B4JEL1 B4K4Z6 B4LW18 B4N8W0 B4PUN3 B4QWM7 C7SAG2 C7SAG3 C7SAG4 P61857 P61858 Q29BM0 Q3BD74 Q3BDH7
FBpp0081524 FBpp0283262 FBpp0207737 FBpp0237990 FBpp0153048 FBpp0172816 FBpp0081524 FBpp0120957 FBpp0135920 FBpp0269789 7217.FBpp0120957 7222.FBpp0153048 7227.FBpp0081524 7237.FBpp0283262 7244.FBpp0237990 7245.FBpp0269789 7260.FBpp0241276 NP_001266328.1.71379 NP_524290.2.81976 XP_001357842.1.19638 XP_001953433.1.52611 XP_001980828.1.56816 XP_001990080.1.65300 XP_001998506.1.58863 XP_002031904.1.34323 XP_002053003.1.90633 XP_002070575.1.14588 XP_002096938.1.41174 XP_002104128.1.80810 XP_005189638.1.65292 XP_011185930.1.96551 XP_011213604.1.45957 XP_014088138.1.97495 XP_015027270.1.90633 XP_016937909.1.48971 XP_016961415.1.21709 XP_016981921.1.97277 XP_017010957.1.47939 XP_017020640.1.37106 XP_017058540.1.74164 XP_017073986.1.81094 XP_017089405.1.53830 XP_017122754.1.32376 XP_017465693.1.95384 XP_017848234.1.30616 XP_017863732.1.65068 XP_018784651.1.52592 FBpp0241276 FBpp0081524 FBpp0219200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]