SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000008521 from Gorilla gorilla 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008521
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.8e-62
Family Hemopexin-like domain 1.11e-06
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-54
Family Matrix metalloproteases, catalytic domain 5.58e-06
Further Details:      
 
Domain Number 3 Region: 18-96
Classification Level Classification E-value
Superfamily PGBD-like 8.95e-21
Family MMP N-terminal domain 0.00059
Further Details:      
 

Protein sequence

External link(s) Protein: ENSGGOP00000008521   Gene: ENSGGOG00000008717   Transcript: ENSGGOT00000008755
Sequence length 513
Comment pep:novel chromosome:gorGor3.1:11:100247462:100262528:-1 gene:ENSGGOG00000008717 transcript:ENSGGOT00000008755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLLLLFLFFITFSSPFPSVRMTENEDNVQLAQAYLNQFYSLEIEGNHLVQSKNRSLID
DKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTP
DMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPRKYPLSQDDINGIQSIYGGLPKVPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKG
RHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDY
PKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPG
ISIRVDAAFQYKGFFYFSRGSKQFEYDIKTKNITRIVRTNTWFQCKEPKNSSFGFDINKE
KAHSGGIKILYHKSLSLFIFGIVHLLKNTSIYQ
Download sequence
Identical sequences G3R045
ENSGGOP00000008521 ENSGGOP00000008521

Jump to [ Top of page · Domain architecture · Domain assignment details ]