SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000012907 from Gorilla gorilla 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012907
Domain Number 1 Region: 282-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.02e-58
Family Hemopexin-like domain 0.00012
Further Details:      
 
Domain Number 2 Region: 81-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-45
Family Matrix metalloproteases, catalytic domain 3.89e-05
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily PGBD-like 1.88e-14
Family MMP N-terminal domain 0.0097
Further Details:      
 

Protein sequence

External link(s) Protein: ENSGGOP00000012907   Gene: ENSGGOG00000013231   Transcript: ENSGGOT00000013279
Sequence length 508
Comment pep:novel chromosome:gorGor3.1:12:53899919:53907324:-1 gene:ENSGGOG00000013231 transcript:ENSGGOT00000013279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPTPMPDPCSSELDAMMLGP
RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNIAHNWMHCRPRTTDTT
PSGGNTTPSGTGITLDTTLSATETTFEY
Download sequence
Identical sequences G3RBP6
ENSGGOP00000012907 ENSGGOP00000012907

Jump to [ Top of page · Domain architecture · Domain assignment details ]