SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000012907 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012907
Domain Number 1 Region: 282-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.02e-58
Family Hemopexin-like domain 0.00012
Further Details:      
 
Domain Number 2 Region: 81-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-45
Family Matrix metalloproteases, catalytic domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000188
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSGGOP00000012907   Gene: ENSGGOG00000013231   Transcript: ENSGGOT00000013279
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:12:53899919:53907324:-1 gene:ENSGGOG00000013231 transcript:ENSGGOT00000013279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPTPMPDPCSSELDAMMLGP
RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNIAHNWMHCRPRTTDTT
PSGGNTTPSGTGITLDTTLSATETTFEY
Download sequence
Identical sequences G3RBP6
ENSGGOP00000012907 ENSGGOP00000012907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]