SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000017139 from Gorilla gorilla 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017139
Domain Number 1 Region: 278-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-67
Family Hemopexin-like domain 1.25e-06
Further Details:      
 
Domain Number 2 Region: 102-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-57
Family Matrix metalloproteases, catalytic domain 6.81e-08
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0008
Further Details:      
 

Protein sequence

External link(s) Protein: ENSGGOP00000017139   Gene: ENSGGOG00000015496   Transcript: ENSGGOT00000033003
Sequence length 471
Comment pep:novel chromosome:gorGor3.1:11:100424999:100437218:-1 gene:ENSGGOG00000015496 transcript:ENSGGOT00000033003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMRAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPT
YKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPNNSEPALCDPNLSFDAVTTVGNKIF
FFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLR
PEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKVIT
KNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC
Download sequence
Identical sequences G3RMX3
ENSGGOP00000017139 ENSGGOP00000015120

Jump to [ Top of page · Domain architecture · Domain assignment details ]