SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000017139 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017139
Domain Number 1 Region: 278-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-67
Family Hemopexin-like domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 102-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-57
Family Matrix metalloproteases, catalytic domain 0.0000000681
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSGGOP00000017139   Gene: ENSGGOG00000015496   Transcript: ENSGGOT00000033003
Sequence length 471
Comment pep:known_by_projection chromosome:gorGor3.1:11:100424999:100437218:-1 gene:ENSGGOG00000015496 transcript:ENSGGOT00000033003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMRAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPT
YKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPNNSEPALCDPNLSFDAVTTVGNKIF
FFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLR
PEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKVIT
KNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC
Download sequence
Identical sequences G3RMX3
ENSGGOP00000017139 ENSGGOP00000015120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]