SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017139 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017139
Domain Number 1 Region: 278-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-67
Family Hemopexin-like domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 102-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-57
Family Matrix metalloproteases, catalytic domain 0.0000000681
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSGGOP00000017139   Gene: ENSGGOG00000015496   Transcript: ENSGGOT00000033003
Sequence length 471
Comment pep:known_by_projection chromosome:gorGor3.1:11:100424999:100437218:-1 gene:ENSGGOG00000015496 transcript:ENSGGOT00000033003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMRAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPT
YKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPNNSEPALCDPNLSFDAVTTVGNKIF
FFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLR
PEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKVIT
KNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC
Download sequence
Identical sequences G3RMX3
ENSGGOP00000017139 ENSGGOP00000015120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]