SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000021432 from Gorilla gorilla 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021432
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-70
Family Hemopexin-like domain 7.34e-06
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-55
Family Matrix metalloproteases, catalytic domain 5.43e-08
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Protein sequence

External link(s) Protein: ENSGGOP00000021432   Gene: ENSGGOG00000027756   Transcript: ENSGGOT00000031736
Sequence length 607
Comment pep:novel chromosome:gorGor3.1:8:86761286:87063492:-1 gene:ENSGGOG00000027756 transcript:ENSGGOT00000031736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences F6XPY4 G3S039 G7PC63 H2QWE3 P51512
ENSP00000286614 9544.ENSMMUP00000017328 9598.ENSPTRP00000034899 9606.ENSP00000286614 ENSPTRP00000034899 ENSP00000286614 ENSMMUP00000017328 ENSGGOP00000021432 ENSGGOP00000021432 ENSPTRP00000034899 ENSMMUP00000017328 gi|13027802|ref|NP_005932.2|

Jump to [ Top of page · Domain architecture · Domain assignment details ]