SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027282 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027282
Domain Number 1 Region: 48-182
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-44
Family Matrix metalloproteases, catalytic domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000502
Family MMP N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66

Protein sequence

External link(s) Protein: ENSGGOP00000027282   Gene: ENSGGOG00000008869   Transcript: ENSGGOT00000027023
Sequence length 182
Comment pep:known_by_projection chromosome:gorGor3.1:11:100357453:100359416:-1 gene:ENSGGOG00000008869 transcript:ENSGGOT00000027023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVSVCPLRGTLAGSTYRIENYTPDLPQ
VDQPLRKPSNWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPG
IGGDAHFDEDERWYNLYRVAAHELGHSLGLSHSTDIGALMYPSYLQDVQLAQDDIDGIQA
IY
Download sequence
Identical sequences G3SGP5
ENSGGOP00000027282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]