SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027282 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027282
Domain Number 1 Region: 48-182
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-44
Family Matrix metalloproteases, catalytic domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000502
Family MMP N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95
Cellular Component IC (bits) H-Score
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
endocytic vesicle 1.514 4.85

Protein sequence

External link(s) Protein: ENSGGOP00000027282   Gene: ENSGGOG00000008869   Transcript: ENSGGOT00000027023
Sequence length 182
Comment pep:known_by_projection chromosome:gorGor3.1:11:100357453:100359416:-1 gene:ENSGGOG00000008869 transcript:ENSGGOT00000027023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVSVCPLRGTLAGSTYRIENYTPDLPQ
VDQPLRKPSNWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPG
IGGDAHFDEDERWYNLYRVAAHELGHSLGLSHSTDIGALMYPSYLQDVQLAQDDIDGIQA
IY
Download sequence
Identical sequences G3SGP5
ENSGGOP00000027282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]