SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSGGOP00000027282 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027282
Domain Number 1 Region: 48-182
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-44
Family Matrix metalloproteases, catalytic domain 1.64e-06
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily PGBD-like 5.02e-15
Family MMP N-terminal domain 0.00055
Further Details:      
 

Protein sequence

External link(s) Protein: ENSGGOP00000027282   Gene: ENSGGOG00000008869   Transcript: ENSGGOT00000027023
Sequence length 182
Comment pep:known_by_projection chromosome:gorGor3.1:11:100357453:100359416:-1 gene:ENSGGOG00000008869 transcript:ENSGGOT00000027023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVSVCPLRGTLAGSTYRIENYTPDLPQ
VDQPLRKPSNWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPG
IGGDAHFDEDERWYNLYRVAAHELGHSLGLSHSTDIGALMYPSYLQDVQLAQDDIDGIQA
IY
Download sequence
Identical sequences G3SGP5
ENSGGOP00000027282

Jump to [ Top of page · Domain architecture · Domain assignment details ]