SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004110 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004110
Domain Number 1 Region: 2-172,271-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.33e-50
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 149-267
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 7.48e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004110   Gene: ENSPANG00000004216   Transcript: ENSPANT00000003489
Sequence length 352
Comment pep:novel chromosome:PapAnu2.0:6:1271372:1299852:-1 gene:ENSPANG00000004216 transcript:ENSPANT00000003489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGPSLL
HTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIEDGSIHRIRAKNTVVATGGYGR
TYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINS
QGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLP
GISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEA
ACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKFPPIKPNAGEESS
Download sequence
Identical sequences ENSPANP00000004110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]