SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008021 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008021
Domain Number 1 Region: 1879-2127
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-57
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 1328-1488
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-25
Family G proteins 0.0021
Further Details:      
 
Domain Number 3 Region: 100-512
Classification Level Classification E-value
Superfamily ARM repeat 4.61e-22
Family Armadillo repeat 0.011
Further Details:      
 
Domain Number 4 Region: 961-1058,1106-1297
Classification Level Classification E-value
Superfamily L domain-like 2.38e-16
Family Internalin LRR domain 0.047
Further Details:      
 
Domain Number 5 Region: 2192-2492
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000015
Family WD40-repeat 0.0097
Further Details:      
 
Domain Number 6 Region: 402-717,748-781
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000599
Family Armadillo repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008021   Gene: ENSPANG00000010275   Transcript: ENSPANT00000025752
Sequence length 2522
Comment pep:known_by_projection chromosome:PapAnu2.0:11:35790621:35932732:1 gene:ENSPANG00000010275 transcript:ENSPANT00000025752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEICPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSMIGLKTLDLLLTSGKITLLILDEESDVFMLIFDAMHSFPASDEIQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPISEKIQEVSCCLLHRLTLGEFLIFLPFSESHNKLVKVEE
TLFENTNLRVSSLKLVKLLTETIFLNQDLEEKNENQENDDEGEEVKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIYLNVLELMQKHLHSPEVAESGCKMLNHLFEGSNTSLDTM
AAVLPKIVTVMKSHETSLPVQLEALRAILHFIVPGMSEESREDAESYHKLNMVKKHCFKN
DIHKLVLAALNRFIGNPGIQKCGLKVISSIAHFTDTLGVLSLEGAVDSVLHTLQMYPDDQ
EIQCLGLSLIGCLITKKNLCIGTGHLLAKILASSLYRFKDVAEVQTEGFQTILAILKLSA
SFSKLLVHHSFDLVIFHQMSSSIMEQKDQQFLNLCCKCFAKVAMDDDLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGTSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
KGDSQIISLLLRRLALDMANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
RMVIRYQMKSAVEEGAASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSSSLGPIFDHEDLLRRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKSCISGHLEHLEKLELHQ
NALTSFPQQLCETFEELLYLYLDSSLKIDFAQHLLRQADLSEFKSSRPAQDCTTVLQPGQ
QSETLSQKKKKKKRLPTWPPNLSITHDAFPLILIQNKISGICSPLRLKELKILNLSKNHI
SSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTSLKLSQNKFTCIPEAILNLPHWNRT
FRNMISIQSYGGNCFLNLLSLMFFRMKPQIMDLDNQIHFVVRTSLLSMSEEMKYIPPEIG
CLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELRLNFDFKHIGCKAKDIIRFLQQR
LKKAVPYNRMKLMVVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRGKRK
RDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSS
PVILVGTHLDVSDERQRKACIGKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTII
NESLNFKIRDQPVVGQLIPDCYVELEKIILSERKNVPIEFPVIDQKRLLQLVRENQLQLD
ENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGI
ISRRDVEKFLSKKRRFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHC
ENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPE
AYCLVGSEVLDNHPESFLKITVPSGRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGE
TLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLP
RNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLC
HLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYL
HSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVAR
GNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELAIQGKLPDPVKEYGCAPWP
MVEKLITKCLKENPQERPTSAQVFDILNSAELVCLTRHILLPKNVIVDCMVATHHNSRNA
SIWLGCGHTNRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVQKESWIVSGTQSGTLL
VINTEDGKKRHTLEKMTDSITCLYCNSFSKQSKQKNFLLVGTADGNLAIFEDKTVKLEGA
APLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFS
YAAFSDSNIVTVVVDTVLYIAKKNSPVVEVWDKKTEKLCELIDCVHFLREVMVKVNKESK
HKMSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRIIYNFCDSVRVMMTAQLGN
LKNVMLVLGYNRKSTEGTQQQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRGTS
IE
Download sequence
Identical sequences ENSPANP00000008021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]