SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014514 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014514
Domain Number 1 Region: 1234-1518
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-56
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 259-508,537-611
Classification Level Classification E-value
Superfamily L domain-like 1.47e-41
Family Leucine rich effector protein YopM 0.053
Further Details:      
 
Domain Number 3 Region: 635-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000144
Family G proteins 0.0085
Further Details:      
 
Domain Number 4 Region: 60-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000017
Family Ankyrin repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 1540-1786
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000022
Family WD40-repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
methyltransferase complex 2.143 21.65
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16

Protein sequence

External link(s) Protein: ENSPANP00000014514   Gene: ENSPANG00000003917   Transcript: ENSPANT00000011163
Sequence length 2015
Comment pep:known_by_projection chromosome:PapAnu2.0:7:75226584:75365243:1 gene:ENSPANG00000003917 transcript:ENSPANT00000011163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDMGSKPSTPGGDPTAQSPRTEGIRA
AYRQGDRGGARDLLKEACDQCTSQLEKGQLLSIPAAYGDLEMVRYLLSERLVELPTEPMD
DNPAVVAAYFGHTAIVQELLESLPGPCSPQRLLNWMLALACQQGHLGVVKLLVLTHGADP
ESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF
IEASALPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWG
LINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTAS
KNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP
DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENSLKEVPLGLFQLDALTFLRL
QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAACVL
EFPAFLSESLEVLCLNDNHLDAVPPSVCLLKSLSELYLGNNPGLRELPPELGQLSNLWQL
DTEDLTISNVPAEIRKEGPKAMLCYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT
GRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY
VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA
LCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG
RLIPRSYLSLQEAVLAEQQRRSLDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFL
IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG
TGFTEQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKM
SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVAIYSFTGNQRNRCSTFRVKR
NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITDHVNSL
IDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEGVQYFDMEDCVLTAIER
DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA
RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIV
ALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKK
NIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV
YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFHRLQALMM
ECWDTKPEKRPLALSVVSQMKDPTFAIFMYELHCGKQTAFFSSQGQEYTVVFWDGKEESR
NYTVVNTEKGLMEVQRMSCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQRA
LDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGAPKDSCSYLCSHTANRSKFS
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYAAPSVVTSVV
CSSEGRGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGDPSPLRDMFPVRPLDMEPLAAS
HTANPKVPEGDSIADVSIMYSEELGTQILTHQESLTDYCSMSSYSSSPPRQAARSPSSLP
SSPASSSSVPFSPDCEDSDRLHEPSAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW
VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCSFENENTE
WCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR
Download sequence
Identical sequences A0A096NNF4
ENSPANP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]