SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018481 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018481
Domain Number 1 Region: 332-903,936-1119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-244
Family Motor proteins 0.00000000204
Further Details:      
 
Domain Number 2 Region: 28-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-81
Family Protein kinases, catalytic subunit 0.000000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Protein: ENSPANP00000018481   Gene: ENSPANG00000005421   Transcript: ENSPANT00000010502
Sequence length 1257
Comment pep:known_by_projection chromosome:PapAnu2.0:12:32116370:32495623:1 gene:ENSPANG00000005421 transcript:ENSPANT00000010502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQRALLSTRKHLYGLFHYNPMMLGLESLPDPTDTWEIIETIGKGTYGKVYKVTNKRDGS
LAAVKILDPISDMDEEIEAEYNILQFLPNHPNVVKFYGMFYKADHCVGGQLWLVLELCNG
GSVTELVKGLLRCGQQLDEAMISYILYGALLGLQHLHSNRIIHRDVKGNNILLTTEGGVK
LVDFGVSAQLTSTRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGD
GDPPLFDMHPVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQCLIKDFERRPSVTHLLDHP
FIKGVHGKVLFLQNQLAKVLQDQKHLNPVTKTRHERMHTRRPYHVEDAEKYCLEDDLVNL
EVLDEDTIIHQLQKRYADLLIYTYVGDILIALNPFQNLSIYSPQFSRLYHGVKRASNPPH
IFASADAAYQCMVTLSKDQCIVISGESGSGKTESAHLIVQHLTFLGKANNQTLREKILQV
NSLVEAFGNACTAINDNSSRFGKYLEMMFTPTGVVMGARISEYLLEKSRVIKQAAGEKNF
HIFYYIYAGLHHQKKLSDFRLPEEKPPRYIADETGRVMHDITSKESYRRQFEAIQHCFRI
IGFTDKEVHSVYRILAGILNIGNIEFAAISSQHQTDKSEVPDAEALQNAASVLCISPEEL
QEALTSHCVVTRGETIIRANTVDRAADVRDAMSKALYGRLFSWIVNRINTLLQPDKNICS
AEDGMNVGILDIFGFENFQRNSFEQLCINIANEQIQYYFNQHVFALEQMEYQNEGIDAIP
VEYEDNRPLLDMFLQKPLGLLALLDEESRFPQATDQTLVDKFEDNLRCKYFWRPKGVELC
FGIQHYAGKVLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLTKTGNLAQTRA
RITVASRSLPPHFSAGKAKVDTLEVIRHPEETTNMKRQTVASYFRYSLMDLLSKMVVGQP
HFVRCIKPNDDREALQFSRERVLAQLRSTGILETVSIRRQGYSHRILFEEFVKRYYYLAF
RAHQTPLASKESCVAILEKSRLDHWVLGKTKVFLKYYHVEQLNLLLREVIGRVVVLQAYT
KGWLGARRYKRVREKREKGAIAIQSAWRGYDARRKFKKISNRRSESAAHNQAEDASNQSS
GTHSPVAVGTRGSAKVQDCSEPGDHKVFRGSVDHRSHSQAESNNGHAQTSSNSRAVTEKN
GHSQARSSPKGCDIFTGHANKHSISGTDLLSSRICHPAPDHQGLSLWGAPQKPGKKN
Download sequence
Identical sequences A0A096NZG0
ENSPANP00000018481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]