SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019999 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019999
Domain Number 1 Region: 13-253
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-69
Family Protein kinases, catalytic subunit 0.00000271
Further Details:      
 
Domain Number 2 Region: 292-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.25e-39
Family Motor proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Protein: ENSPANP00000019999   Gene: ENSPANG00000023025   Transcript: ENSPANT00000021027
Sequence length 412
Comment pep:novel chromosome:PapAnu2.0:9:25445114:25573468:1 gene:ENSPANG00000023025 transcript:ENSPANT00000021027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKQQSKFLIQFTILMKRLKQSITYLKALSDHRNVVRFYGIYFKKDKVNGDKLWLVLEL
CNGGSVTDLVKGFLKRGERMSEPLIAYILHEALMGLQHLHNNKTIHRDVKGNNILLTTEG
GVKLVDFGVSAQLTSTRHRRNTSVGTPFWMAPEVIACEQQLDTTYDARCDTWSLGITAIE
LGDGDPPLADLHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSDLL
QHKFITQIEGKDVMLQKQLMEFIGIHQCMGGTEKARHERIYTKKGNFNWSLISNLKDVDD
LATLEVLDENTVSEQLEKCYSRDQIYIYVGDILIALNPFQSLDLYSTKHSKLYIGSKRTA
SPPHIFAMADLGYQSMITYNSDQCIVISGESGAGKTESAHLLVQQLTVLGKV
Download sequence
Identical sequences A0A096P3S4
ENSPANP00000019999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]