SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000260227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260227
Domain Number 1 Region: 97-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.89e-56
Family Matrix metalloproteases, catalytic domain 0.0000000508
Further Details:      
 
Domain Number 2 Region: 23-92
Classification Level Classification E-value
Superfamily PGBD-like 3.92e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66

Protein sequence

External link(s) Protein: ENSP00000260227   Gene: ENSG00000137673   Transcript: ENST00000260227
Sequence length 267
Comment pep:known chromosome:GRCh38:11:102520508:102530753:-1 gene:ENSG00000137673 transcript:ENST00000260227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Download sequence
Identical sequences P09237
ENSP00000260227 ENSP00000260227 gi|4505219|ref|NP_002414.1| ENSP00000260227 9606.ENSP00000260227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]