SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000260227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260227
Domain Number 1 Region: 97-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.89e-56
Family Matrix metalloproteases, catalytic domain 5.08e-08
Further Details:      
 
Domain Number 2 Region: 23-92
Classification Level Classification E-value
Superfamily PGBD-like 3.92e-21
Family MMP N-terminal domain 0.0011
Further Details:      
 

Protein sequence

External link(s) Protein: ENSP00000260227   Gene: ENSG00000137673   Transcript: ENST00000260227
Sequence length 267
Comment pep:known chromosome:GRCh38:11:102520508:102530753:-1 gene:ENSG00000137673 transcript:ENST00000260227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Download sequence
Identical sequences P09237
ENSP00000260227 9606.ENSP00000260227 ENSP00000260227 gi|4505219|ref|NP_002414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]