SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000260228 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260228
Domain Number 1 Region: 290-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-60
Family Hemopexin-like domain 6.23e-06
Further Details:      
 
Domain Number 2 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 4.79e-06
Further Details:      
 
Domain Number 3 Region: 29-105
Classification Level Classification E-value
Superfamily PGBD-like 1.18e-17
Family MMP N-terminal domain 0.00073
Further Details:      
 

Protein sequence

External link(s) Protein: ENSP00000260228   Gene: ENSG00000137674   Transcript: ENST00000260228
Sequence length 483
Comment pep:known chromosome:GRCh38:11:102576835:102625332:-1 gene:ENSG00000137674 transcript:ENST00000260228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
Download sequence
Identical sequences O60882
ENSP00000260228 9606.ENSP00000260228 ENSP00000260228 gi|45359865|ref|NP_004762.2|

Jump to [ Top of page · Domain architecture · Domain assignment details ]