SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000260228 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260228
Domain Number 1 Region: 290-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-60
Family Hemopexin-like domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 0.00000479
Further Details:      
 
Domain Number 3 Region: 29-105
Classification Level Classification E-value
Superfamily PGBD-like 1.18e-17
Family MMP N-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96

Protein sequence

External link(s) Protein: ENSP00000260228   Gene: ENSG00000137674   Transcript: ENST00000260228
Sequence length 483
Comment pep:known chromosome:GRCh38:11:102576835:102625332:-1 gene:ENSG00000137674 transcript:ENST00000260228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
Download sequence
Identical sequences O60882
ENSP00000260228 gi|45359865|ref|NP_004762.2| ENSP00000260228 ENSP00000260228 9606.ENSP00000260228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]