SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSP00000260228 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260228
Domain Number 1 Region: 290-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-60
Family Hemopexin-like domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 0.00000479
Further Details:      
 
Domain Number 3 Region: 29-105
Classification Level Classification E-value
Superfamily PGBD-like 1.18e-17
Family MMP N-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1

Protein sequence

External link(s) Protein: ENSP00000260228   Gene: ENSG00000137674   Transcript: ENST00000260228
Sequence length 483
Comment pep:known chromosome:GRCh38:11:102576835:102625332:-1 gene:ENSG00000137674 transcript:ENST00000260228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
Download sequence
Identical sequences O60882
gi|45359865|ref|NP_004762.2| ENSP00000260228 ENSP00000260228 9606.ENSP00000260228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]