SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000300762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300762
Domain Number 1 Region: 94-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-56
Family Matrix metalloproteases, catalytic domain 1.81e-05
Further Details:      
 
Weak hits

Sequence:  ENSP00000300762
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000451
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07
Cellular Component IC (bits) H-Score
brush border 1.48 22.54
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11
dendrite 1.547 7.03

Protein sequence

External link(s) Protein: ENSP00000300762   Gene: ENSG00000167346   Transcript: ENST00000300762
Sequence length 261
Comment pep:known chromosome:GRCh38:11:4988194:4992427:1 gene:ENSG00000167346 transcript:ENST00000300762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Download sequence
Identical sequences Q9NRE1
ENSP00000300762 ENSP00000369753 9606.ENSP00000300762 ENSP00000300762 GO.101538 MPIB-421 gi|73808266|ref|NP_068573.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]