SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000300762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300762
Domain Number 1 Region: 94-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-56
Family Matrix metalloproteases, catalytic domain 0.0000181
Further Details:      
 
Weak hits

Sequence:  ENSP00000300762
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000451
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66
host cell part 1.975 5.63
secretory vesicle 1.533 5.3
lysosomal membrane 1.935 5.22
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.069 165.83
endopeptidase activity 1.546 149.87
zinc ion binding 1.604 43.07
growth factor receptor binding 2.194 16.01
cytokine receptor binding 1.987 16.01
enzyme activator activity 1.476 14.68
integrin binding 1.583 12.57
amide binding 1.601 9.87
fibronectin binding 2.245 5.13
protein transporter activity 2.138 5.12

Protein sequence

External link(s) Protein: ENSP00000300762   Gene: ENSG00000167346   Transcript: ENST00000300762
Sequence length 261
Comment pep:known chromosome:GRCh38:11:4988194:4992427:1 gene:ENSG00000167346 transcript:ENST00000300762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Download sequence
Identical sequences Q9NRE1
GO.101538 MPIB-421 ENSP00000300762 ENSP00000300762 ENSP00000369753 ENSP00000300762 ENSP00000369753 9606.ENSP00000300762 gi|73808266|ref|NP_068573.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]