SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000300762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300762
Domain Number 1 Region: 94-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-56
Family Matrix metalloproteases, catalytic domain 1.81e-05
Further Details:      
 
Weak hits

Sequence:  ENSP00000300762
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000451
Family MMP N-terminal domain 0.012
Further Details:      
 

Protein sequence

External link(s) Protein: ENSP00000300762   Gene: ENSG00000167346   Transcript: ENST00000300762
Sequence length 261
Comment pep:known chromosome:GRCh38:11:4988194:4992427:1 gene:ENSG00000167346 transcript:ENST00000300762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Download sequence
Identical sequences Q9NRE1
ENSP00000300762 ENSP00000369753 9606.ENSP00000300762 ENSP00000300762 GO.101538 MPIB-421 gi|73808266|ref|NP_068573.2|

Jump to [ Top of page · Domain architecture · Domain assignment details ]