SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000322788 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000322788
Domain Number 1 Region: 272-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-71
Family Hemopexin-like domain 1.94e-09
Further Details:      
 
Domain Number 2 Region: 103-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.75e-58
Family Matrix metalloproteases, catalytic domain 7.19e-08
Further Details:      
 
Domain Number 3 Region: 21-97
Classification Level Classification E-value
Superfamily PGBD-like 3.3e-21
Family MMP N-terminal domain 4.02e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSP00000322788   Gene: ENSG00000196611   Transcript: ENST00000315274
Sequence length 469
Comment pep:known chromosome:GRCh38:11:102789920:102798160:-1 gene:ENSG00000196611 transcript:ENST00000315274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Download sequence
Identical sequences P03956
ENSP00000322788 9606.ENSP00000322788 ENSP00000322788 MPIB-401 gi|4505215|ref|NP_002412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]