SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000322788 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000322788
Domain Number 1 Region: 272-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-71
Family Hemopexin-like domain 0.00000000194
Further Details:      
 
Domain Number 2 Region: 103-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.75e-58
Family Matrix metalloproteases, catalytic domain 0.0000000719
Further Details:      
 
Domain Number 3 Region: 21-97
Classification Level Classification E-value
Superfamily PGBD-like 3.3e-21
Family MMP N-terminal domain 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95

Protein sequence

External link(s) Protein: ENSP00000322788   Gene: ENSG00000196611   Transcript: ENST00000315274
Sequence length 469
Comment pep:known chromosome:GRCh38:11:102789920:102798160:-1 gene:ENSG00000196611 transcript:ENST00000315274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Download sequence
Identical sequences P03956
MPIB-401 ENSP00000322788 9606.ENSP00000322788 ENSP00000322788 ENSP00000322788 gi|4505215|ref|NP_002412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]