SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000372459 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372459
Domain Number 1 Region: 370-582
Classification Level Classification E-value
Superfamily ARM repeat 2.4e-28
Family MIF4G domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372459   Gene: ENSG00000134030   Transcript: ENST00000382998
Sequence length 600
Comment pep:known chromosome:GRCh38:18:48539158:48861906:1 gene:ENSG00000134030 transcript:ENST00000382998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQ
WTADCSEPLDSSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL
DFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEI
AHTKKLFRRRRNDRRRQQRPPGGNKPQQHGDHQPGSAKHNRDHQKSYQGGSAPHPSGRPT
HHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSP
DTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRLRRRLKEKVPD
EVAVETTTPQQNKMDKLIEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIY
QKAVSDRSFAFTAAKLCDKMALFMVEGTKFRSLLLNMLQKDFTVREELQQQDVERWLGFI
TFLCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQ
LPEMMTELLASARDKMLCPSESMLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA
Download sequence
Identical sequences NP_001135869.1.87134 NP_001135869.1.92137 XP_003827250.1.60992 XP_006722650.1.92137 XP_006722651.1.92137 XP_006722652.1.92137 XP_008950794.1.60992 XP_008950795.1.60992 XP_016881591.1.92137 gi|215422401|ref|NP_001135869.1| ENSP00000372459 ENSP00000372459 9606.ENSP00000372459 ENSP00000372459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]