SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000441106 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441106
Domain Number 1 Region: 246-440
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-65
Family Hemopexin-like domain 0.00000509
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-44
Family Matrix metalloproteases, catalytic domain 0.0000725
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000589
Family MMP N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSP00000441106   Gene: ENSG00000198598   Transcript: ENST00000535291
Sequence length 519
Comment pep:known chromosome:GRCh38:12:131838056:131851783:1 gene:ENSG00000198598 transcript:ENST00000535291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRT
FPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPG
GTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHS
IMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPP
RKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDS
VDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTY
FFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDG
ELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCT
SGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL
Download sequence
Identical sequences ENSP00000441106 ENSP00000441106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]