SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000441106 from Homo sapiens 73_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441106
Domain Number 1 Region: 246-440
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-65
Family Hemopexin-like domain 5.09e-06
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-44
Family Matrix metalloproteases, catalytic domain 7.25e-05
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 5.89e-10
Family MMP N-terminal domain 0.0055
Further Details:      
 

Protein sequence

External link(s) Protein: ENSP00000441106   Gene: ENSG00000198598   Transcript: ENST00000535291
Sequence length 519
Comment pep:known chromosome:GRCh37:12:132322601:132336328:1 gene:ENSG00000198598 transcript:ENST00000535291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRT
FPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPG
GTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHS
IMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPP
RKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDS
VDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTY
FFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDG
ELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCT
SGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL
Download sequence
Identical sequences ENSP00000441106

Jump to [ Top of page · Domain architecture · Domain assignment details ]