SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSP00000441106 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441106
Domain Number 1 Region: 246-440
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-65
Family Hemopexin-like domain 0.00000509
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-44
Family Matrix metalloproteases, catalytic domain 0.0000725
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000589
Family MMP N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSP00000441106   Gene: ENSG00000198598   Transcript: ENST00000535291
Sequence length 519
Comment pep:known chromosome:GRCh38:12:131838056:131851783:1 gene:ENSG00000198598 transcript:ENST00000535291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSWRVRT
FPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPG
GTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHS
IMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPP
RKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDS
VDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTY
FFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDG
ELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCT
SGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL
Download sequence
Identical sequences ENSP00000441106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]