SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000218439 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000218439
Domain Number - Region: 481-604
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 0.0157
Family Putative modulator of DNA gyrase, PmbA/TldD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000218439   Gene: ENSG00000102316   Transcript: ENST00000218439
Sequence length 606
Comment pep:known chromosome:GRCh38:X:54808338:54815694:1 gene:ENSG00000102316 transcript:ENST00000218439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKA
SGVSKATEVSKTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPA
TETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKV
KHLDGEEDGSSDQSQASGTTGGRRVSKALMASMARRASRGPIAFWARRASRTRLAAWARR
ALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPI
KRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGIL
GTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME
ADLKAAAEAAAEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAK
AQESGSASTGASTSTNNSASASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGA
CGFSYK
Download sequence
Identical sequences A0A024R9Y7 Q9UNF1
ENSP00000218439 ENSP00000364193 ENSP00000364198 ENSP00000364209 ENSP00000379526 9606.ENSP00000218439 ENSP00000218439 NP_055414.2.87134 NP_055414.2.92137 NP_803182.1.87134 NP_803182.1.92137 NP_957516.1.87134 NP_957516.1.92137 ENSP00000218439 ENSP00000364193 ENSP00000364198 ENSP00000364209 ENSP00000379526 gi|19387846|ref|NP_055414.2| gi|29171705|ref|NP_803182.1| gi|41350320|ref|NP_957516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]