SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265840 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265840   Gene: ENSG00000110675   Transcript: ENST00000265840
Sequence length 334
Comment pep:known chromosome:GRCh38:11:107591230:107666779:1 gene:ENSG00000110675 transcript:ENST00000265840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRD
SKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVE
KLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLG
LYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVG
INITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFN
RVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
Download sequence
Identical sequences Q8N336
HR5237 gi|112181294|ref|NP_061182.3| NP_061182.3.87134 NP_061182.3.92137 ENSP00000265840 ENSP00000265840 ENSP00000412257 9606.ENSP00000265840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]