SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000308535 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308535   Gene: ENSG00000174567   Transcript: ENST00000308302
Sequence length 132
Comment pep:known chromosome:GRCh38:1:204198160:204214092:-1 gene:ENSG00000174567 transcript:ENST00000308302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFF
QRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGA
LFRRLQGTSSMV
Download sequence
Identical sequences Q6ZVE7
ENSP00000308535 gi|38348211|ref|NP_940849.1| 9606.ENSP00000308535 NP_940849.1.87134 NP_940849.1.92137 ENSP00000308535 ENSP00000308535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]