SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000332766 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332766   Gene: ENSG00000183979   Transcript: ENST00000333383
Sequence length 125
Comment pep:known chromosome:GRCh37:17:79859985:79860781:1 gene:ENSG00000183979 transcript:ENST00000333383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR
GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA
DCLAA
Download sequence
Identical sequences Q8NG41
ENSP00000332766 ENSP00000332766 9606.ENSP00000332766 gi|22507403|ref|NP_683694.1| NP_683694.1.87134 NP_683694.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]