SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000339328 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000339328
Domain Number 1 Region: 109-209
Classification Level Classification E-value
Superfamily Snake toxin-like 1.7e-44
Family Extracellular domain of cell surface receptors 0.00000168
Further Details:      
 
Domain Number 2 Region: 215-295
Classification Level Classification E-value
Superfamily Snake toxin-like 1.96e-18
Family Extracellular domain of cell surface receptors 0.0000134
Further Details:      
 
Domain Number 3 Region: 23-101
Classification Level Classification E-value
Superfamily Snake toxin-like 3.59e-16
Family Extracellular domain of cell surface receptors 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339328   Gene: ENSG00000011422   Transcript: ENST00000340093
Sequence length 335
Comment pep:known chromosome:GRCh37:19:44152732:44174502:-1 gene:ENSG00000011422 transcript:ENST00000340093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Download sequence
Identical sequences Q03405
ENSP00000339328 ENSP00000339328 gi|4505865|ref|NP_002650.1| ENSP00000339328 NP_002650.1.87134 NP_002650.1.92137 PLAUR Q03405 9606.ENSP00000339328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]