SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000342630 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000342630
Domain Number 1 Region: 315-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-71
Family Nuclear receptor ligand-binding domain 0.000000000573
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342630   Gene: ENSG00000091831   Transcript: ENST00000338799
Sequence length 595
Comment pep:known chromosome:GRCh37:6:152125566:152420188:1 gene:ENSG00000091831 transcript:ENST00000338799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Download sequence
Identical sequences G4XH65 P03372
ENSP00000206249 ENSP00000342630 ENSP00000387500 ENSP00000405330 gi|170295800|ref|NP_001116212.1| gi|170295802|ref|NP_001116213.1| gi|170295804|ref|NP_001116214.1| gi|62821794|ref|NP_000116.2| NP_000116.2.87134 NP_000116.2.92137 NP_001116212.1.87134 NP_001116212.1.92137 NP_001116213.1.87134 NP_001116213.1.92137 NP_001116214.1.87134 NP_001116214.1.92137 XP_011533845.1.92137 XP_011533846.1.92137 XP_011533847.1.92137 XP_016865865.1.92137 XP_016865866.1.92137 XP_016865867.1.92137 XP_016865868.1.92137 XP_016865869.1.92137 XP_016865870.1.92137 ENSP00000206249 ENSP00000342630 ENSP00000387500 ENSP00000405330 HR4801 ENSP00000342630 9606.ENSP00000206249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]