SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|506935685|ref|YP_008016123.1| from Amycolatopsis orientalis HCCB10007

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|506935685|ref|YP_008016123.1|
Domain Number 1 Region: 26-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-40
Family Eukaryotic proteases 0.012
Further Details:      
 
Domain Number 2 Region: 300-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000136
Family Prokaryotic proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|506935685|ref|YP_008016123.1|
Sequence length 522
Comment peptidase S1 and S6 chymotrypsin/Hap [Amycolatopsis orientalis HCCB10007]
Sequence
MLIEFRGHGPATVIRMRIRSLALALTLMTATAAPAAAVIGGTESTTPYDFMVSLQYEAPR
PDGHRCGAVLIAPQWAVTAGHCANTPNGATAGVPRGWKVRVGSLDTTAGGEVTEVDKFYR
RHLSYNPPGEDIALLHLREPVRAKPIRLAASSPAVGTPVRILGWGAASTGCGDFADPKCY
PSKLREADTEVVPLDRCWDDDGHTLPLCVGRTDPPVGPGMTDSGGPALIRSGDGWALAGT
VIGPGIRGSDFPDMYTDVAKNSAWIDGIVTGTDVPPDDPGPNVEGTAAVGDCVGAVVRPA
SARPHDPALVLTNGHCVPSGRPAPGKALVDRPADLPRPVTIAGRDGYPKSSAGATRLVYA
TMTGTDIALYRLNKTYAQLAREGAKVFRLTTTPMRAGDRLLMSYSSGRPQCTIEAVVPHL
REAGYQQDDAVRYAQSDTCMSRPGASGSALLSLDGNTVMGVNNTHNRDGGRCTEGNPCEV
GRDGTVTAVQGRGYGQQVHRISACLTKGARLDLSRPGCRLPA
Download sequence
Identical sequences R4T4E4
gi|506935685|ref|YP_008016123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]