SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319760305|ref|YP_004124243.1| from Candidatus Blochmannia vafer str. BVAF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319760305|ref|YP_004124243.1|
Domain Number 1 Region: 217-460
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 4.84e-70
Family Tetrapyrrole methylase 0.000000254
Further Details:      
 
Domain Number 2 Region: 114-201
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 5.36e-23
Family Siroheme synthase middle domains-like 0.00019
Further Details:      
 
Domain Number 3 Region: 1-112
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.35e-18
Family Siroheme synthase N-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319760305|ref|YP_004124243.1|
Sequence length 465
Comment siroheme synthase [Candidatus Blochmannia vafer str. BVAF]
Sequence
MKYLPLFINFNKKSILVVGGGIVAFRKIQILRKSGAIINIVARVLCPNLKKILFLEKIIW
IGKTFQPSMLDGIFLIIISTNNIFLNNVIFKHAEKRRILINTVDNKSTCSCIFPAIIDRS
PIIIGISSFGTAPVLIRILREKLESLIPASIGYLAELAGTWRDRVKRYIKNISCRRQFWE
NLFYSGRILFLIEQGKIDQANKIIQNTIKLNKLNIKKKGSVALVGAGPGDKELLTIRGLQ
LMQQADIILYDNLVNPDILDLARRDADKIYVGKSANKHSISQDRLNNFMIQLAQKGNDIV
RLKGGDSFIFGRGGEELLAISKAGIEFQVVPGITAAIGVAAYSGIPLTHRKYAHSVVFIT
GHEQCNNDYYQINWKSLSDKYQTIVIYMGKLNILNISKNLICNGRHINTPVAIISRGTYK
DQKILIGTLIELEKLVLTAKQPVLLIVGEVVSLHDKISWFGSNKN
Download sequence
Identical sequences E8Q5S2
gi|319760305|ref|YP_004124243.1| WP_013516494.1.4849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]