SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTSYP00000005928 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000005928
Domain Number 1 Region: 271-462
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.11e-65
Family Hemopexin-like domain 5.83e-07
Further Details:      
 
Domain Number 2 Region: 98-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.31e-55
Family Matrix metalloproteases, catalytic domain 1.92e-07
Further Details:      
 
Domain Number 3 Region: 20-94
Classification Level Classification E-value
Superfamily PGBD-like 6.75e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Protein sequence

External link(s) Protein: ENSTSYP00000005928   Gene: ENSTSYG00000006474   Transcript: ENSTSYT00000006474
Sequence length 464
Comment pep:known_by_projection scaffold:tarSyr1:scaffold_16970:15596:27609:1 gene:ENSTSYG00000006474 transcript:ENSTSYT00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQMLLFLLLLHMQVATAFPTPSEEKSTTMVQDYLEKFYQLPSSRYRSARKNSTSMIVEK
LKEMQRFFGLNVTGKPDAETLETMEKPRCGVPDRGDFMLTPGNPKWKHTNLTYRIINYTP
QLSEADVHSSIERAFELWSHASPLRFTRISQGEPDIKIAFVQRDHGDNSPFDGPNGILAH
AFQPGQGIGGDAHFDAEETWTKTSANYNLFLVAAHEFGHSLGLSHSSDPGALMYPNYAFR
EPSTYLLPQDDINGIQAIYGPSDNPIQPTGPSTPRTCDPRLTFDAITTLRGEIFFFRDKY
FWRRHPQLRSIEFNFISLFWPALPDSIQAAYEDLDRDLVFLFKGNQYWAMNGYDLQPGYP
RDISNYGFPSNVQAIDAAVYFRSKTYFFVNDQFWRYDNERQTMEPGYPKSTLSIFPGIES
KVDAVFQQNYFFFFFSGPRFYAFDLQAHRVTRVDRSNRWLNCRS
Download sequence
Identical sequences ENSTSYP00000005928 ENSTSYP00000005928

Jump to [ Top of page · Domain architecture · Domain assignment details ]