SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000005928 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000005928
Domain Number 1 Region: 271-462
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.11e-65
Family Hemopexin-like domain 0.000000583
Further Details:      
 
Domain Number 2 Region: 98-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.31e-55
Family Matrix metalloproteases, catalytic domain 0.000000192
Further Details:      
 
Domain Number 3 Region: 20-94
Classification Level Classification E-value
Superfamily PGBD-like 6.75e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSTSYP00000005928   Gene: ENSTSYG00000006474   Transcript: ENSTSYT00000006474
Sequence length 464
Comment pep:known_by_projection scaffold:tarSyr1:scaffold_16970:15596:27609:1 gene:ENSTSYG00000006474 transcript:ENSTSYT00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQMLLFLLLLHMQVATAFPTPSEEKSTTMVQDYLEKFYQLPSSRYRSARKNSTSMIVEK
LKEMQRFFGLNVTGKPDAETLETMEKPRCGVPDRGDFMLTPGNPKWKHTNLTYRIINYTP
QLSEADVHSSIERAFELWSHASPLRFTRISQGEPDIKIAFVQRDHGDNSPFDGPNGILAH
AFQPGQGIGGDAHFDAEETWTKTSANYNLFLVAAHEFGHSLGLSHSSDPGALMYPNYAFR
EPSTYLLPQDDINGIQAIYGPSDNPIQPTGPSTPRTCDPRLTFDAITTLRGEIFFFRDKY
FWRRHPQLRSIEFNFISLFWPALPDSIQAAYEDLDRDLVFLFKGNQYWAMNGYDLQPGYP
RDISNYGFPSNVQAIDAAVYFRSKTYFFVNDQFWRYDNERQTMEPGYPKSTLSIFPGIES
KVDAVFQQNYFFFFFSGPRFYAFDLQAHRVTRVDRSNRWLNCRS
Download sequence
Identical sequences ENSTSYP00000005928 ENSTSYP00000005928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]