SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000006859 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006859
Domain Number 1 Region: 27-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-24
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 333-411
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000111
Family Hemopexin-like domain 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000006859
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.00479
Family MMP N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 11.95
serine hydrolase activity 1.585 10.43
peptide transporter activity 1.652 9.95
Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
Golgi membrane 1.599 10.24
trans-Golgi network 1.734 10.24
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02

Protein sequence

External link(s) Protein: ENSTSYP00000006859   Gene: ENSTSYG00000007482   Transcript: ENSTSYT00000007484
Sequence length 445
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_113:172:7687:1 gene:ENSTSYG00000007482 transcript:ENSTSYT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPPPDPAQAQLQSPAKLRDAIKVMQRFAGLPETGLMDLVTMATMRKPRCSLP
DLLGAAGLVRRRRRYALGGSIWKKRTLTWRVRSFPQGSQLSQETVRVLMSYALAAWGVES
GLAFHEVDSLRDQEPDILIDFARAYHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEE
TWTFGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFEGSPAQVRLEGSHLQPGGAQFQGGEVEMSEEVDSVLPPLNGKTYLLWGQEGCPRNP
SFWRGVTHPDPDGVTVSNTGDPYCCKGTHYWHFPKNSDKTHPDPQPMGLEWPDSTTPRVI
PRRGAALAKTKHWPVPLWGLPLGAT
Download sequence
Identical sequences ENSTSYP00000006859 ENSTSYP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]