SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTSYP00000006859 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006859
Domain Number 1 Region: 27-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-24
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 333-411
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000111
Family Hemopexin-like domain 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000006859
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.00479
Family MMP N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSTSYP00000006859   Gene: ENSTSYG00000007482   Transcript: ENSTSYT00000007484
Sequence length 445
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_113:172:7687:1 gene:ENSTSYG00000007482 transcript:ENSTSYT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPPPDPAQAQLQSPAKLRDAIKVMQRFAGLPETGLMDLVTMATMRKPRCSLP
DLLGAAGLVRRRRRYALGGSIWKKRTLTWRVRSFPQGSQLSQETVRVLMSYALAAWGVES
GLAFHEVDSLRDQEPDILIDFARAYHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEE
TWTFGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFEGSPAQVRLEGSHLQPGGAQFQGGEVEMSEEVDSVLPPLNGKTYLLWGQEGCPRNP
SFWRGVTHPDPDGVTVSNTGDPYCCKGTHYWHFPKNSDKTHPDPQPMGLEWPDSTTPRVI
PRRGAALAKTKHWPVPLWGLPLGAT
Download sequence
Identical sequences ENSTSYP00000006859 ENSTSYP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]