SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000006859 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006859
Domain Number 1 Region: 27-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-24
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 333-411
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.0000111
Family Hemopexin-like domain 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000006859
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.00479
Family MMP N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
organelle subcompartment 1.51 10.12
Golgi membrane 1.579 10.12
trans-Golgi network 2.053 10.12
exocytic vesicle 2.005 10.08
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.069 165.83
endopeptidase activity 1.546 149.87
zinc ion binding 1.604 43.07
growth factor receptor binding 2.194 16.01
cytokine receptor binding 1.987 16.01
enzyme activator activity 1.476 14.68
integrin binding 1.583 12.57
serine hydrolase activity 1.552 10.79
amide binding 1.601 9.87
fibronectin binding 2.245 5.13

Protein sequence

External link(s) Protein: ENSTSYP00000006859   Gene: ENSTSYG00000007482   Transcript: ENSTSYT00000007484
Sequence length 445
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_113:172:7687:1 gene:ENSTSYG00000007482 transcript:ENSTSYT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPPPDPAQAQLQSPAKLRDAIKVMQRFAGLPETGLMDLVTMATMRKPRCSLP
DLLGAAGLVRRRRRYALGGSIWKKRTLTWRVRSFPQGSQLSQETVRVLMSYALAAWGVES
GLAFHEVDSLRDQEPDILIDFARAYHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEE
TWTFGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFEGSPAQVRLEGSHLQPGGAQFQGGEVEMSEEVDSVLPPLNGKTYLLWGQEGCPRNP
SFWRGVTHPDPDGVTVSNTGDPYCCKGTHYWHFPKNSDKTHPDPQPMGLEWPDSTTPRVI
PRRGAALAKTKHWPVPLWGLPLGAT
Download sequence
Identical sequences ENSTSYP00000006859 ENSTSYP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]