SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTSYP00000006859 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006859
Domain Number 1 Region: 27-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-24
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 333-411
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.11e-05
Family Hemopexin-like domain 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000006859
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.00479
Family MMP N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSTSYP00000006859   Gene: ENSTSYG00000007482   Transcript: ENSTSYT00000007484
Sequence length 445
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_113:172:7687:1 gene:ENSTSYG00000007482 transcript:ENSTSYT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPPPDPAQAQLQSPAKLRDAIKVMQRFAGLPETGLMDLVTMATMRKPRCSLP
DLLGAAGLVRRRRRYALGGSIWKKRTLTWRVRSFPQGSQLSQETVRVLMSYALAAWGVES
GLAFHEVDSLRDQEPDILIDFARAYHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEE
TWTFGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFEGSPAQVRLEGSHLQPGGAQFQGGEVEMSEEVDSVLPPLNGKTYLLWGQEGCPRNP
SFWRGVTHPDPDGVTVSNTGDPYCCKGTHYWHFPKNSDKTHPDPQPMGLEWPDSTTPRVI
PRRGAALAKTKHWPVPLWGLPLGAT
Download sequence
Identical sequences ENSTSYP00000006859 ENSTSYP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]