SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSTSYP00000006859 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006859
Domain Number 1 Region: 27-186
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-24
Family Matrix metalloproteases, catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 333-411
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.11e-05
Family Hemopexin-like domain 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000006859
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily PGBD-like 0.00479
Family MMP N-terminal domain 0.01
Further Details:      
 

Protein sequence

External link(s) Protein: ENSTSYP00000006859   Gene: ENSTSYG00000007482   Transcript: ENSTSYT00000007484
Sequence length 445
Comment pep:novel genescaffold:tarSyr1:GeneScaffold_113:172:7687:1 gene:ENSTSYG00000007482 transcript:ENSTSYT00000007484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRYGYLPPPDPAQAQLQSPAKLRDAIKVMQRFAGLPETGLMDLVTMATMRKPRCSLP
DLLGAAGLVRRRRRYALGGSIWKKRTLTWRVRSFPQGSQLSQETVRVLMSYALAAWGVES
GLAFHEVDSLRDQEPDILIDFARAYHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEE
TWTFGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXFEGSPAQVRLEGSHLQPGGAQFQGGEVEMSEEVDSVLPPLNGKTYLLWGQEGCPRNP
SFWRGVTHPDPDGVTVSNTGDPYCCKGTHYWHFPKNSDKTHPDPQPMGLEWPDSTTPRVI
PRRGAALAKTKHWPVPLWGLPLGAT
Download sequence
Identical sequences ENSTSYP00000006859 ENSTSYP00000006859

Jump to [ Top of page · Domain architecture · Domain assignment details ]